(data stored in ACNUC7421 zone)

EMBL: CP001658.PE108

CP001658.PE108       Location/Qualifiers
FT   CDS_pept        complement(124111..124395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00106"
FT                   /product="50S ribosomal protein rpmB1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23129"
FT                   /protein_id="ACT23129.1"
FT                   /translation="MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDR
FT                   RIKVRVSAQGIKVIDRDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL"
     atgtccgccc gctgccaaat caccggccgc actgtgggtt tcggtaaggc tgtgtcgcac        60
     tcacaccgcc gcactcggcg acgttggccg cccaatatcc agctcaaggc ctactactta       120
     ccgtcggagg accgccgcat caaggtgcgg gtcagcgccc aaggaatcaa ggtcatcgac       180
     cgcgacgggc atcgaggccg tcgtcgcgcg gctcgggcag gatccgcccc ggcgcacttc       240
     gcgcgccaag cgggctcatc gctccgaacg gcggcgatcc tgtga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page