(data stored in ACNUC7421 zone)

EMBL: CP001658.PE109

CP001658.PE109       Location/Qualifiers
FT   CDS_pept        124505..125701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23130"
FT                   /protein_id="ACT23130.1"
FT                   /translation="MRTPVILVAGQDHTDEVTGALLRRTGTVVVEHRFDGHVVRRMTAT
FT                   LSRGELITTEDALEFAHGCVSCTIRDDLLVLLRRLHRRDNVGRIVVHLAPWLEPQPICW
FT                   AIDHVRVCVGHGYPDGPAALDVRVAAVVTCVDCVRWLPQSLGEDELPDGRTVAQVTVGQ
FT                   AEFADLLVLTHPEPVAVAVLRRLAPRARITGGVDRVELALAHLDDNSRRGRTDTPHTPL
FT                   LAGLPPLAADGEVAIVEFSARRPFHPQRLHAAVDLLLDGVVRTRGRLWLANRPDQVMWL
FT                   ESAGGGLRVASAGKWLAAMAASEVAYVDLERRLFADLMWVYPFGDRHTAMTVLVCGADP
FT                   TDIVNALNAALLSDDEMASPQRWQSYVDPFGDWHDDPCHEMPDAAGEFSAHRNSGESR"
     atgcgtactc cggtgatatt ggtggcaggt caggatcaca ccgacgaggt gacgggcgcc        60
     ttgttgcgcc ggaccggaac ggtggtcgtg gagcaccggt ttgacggcca tgtggtgcga       120
     cggatgactg ccacgctgag ccgtggcgaa ttgatcacca cggaggacgc tttggagttc       180
     gcccacggct gtgtgtcgtg cacaatccgc gacgacctgc tggtgctgtt acgcagactg       240
     caccgccgag acaatgtcgg ccggatcgtc gtgcacctgg cgccgtggct ggagccccag       300
     cccatctgct gggcgatcga ccacgtgcgg gtttgcgtcg gacacggata cccagacgga       360
     ccagccgccc tcgacgtgcg ggtcgcggcc gtggtgacct gtgtggactg cgtaaggtgg       420
     ctgccgcagt cactcggcga ggacgaactg cccgacgggc gcacggtggc ccaagtgacg       480
     gtcggtcagg ccgagttcgc cgaccttctg gtgctgaccc acccggaacc ggtcgccgtg       540
     gcggttctgc gccgactggc ccctcgagcg cgaatcaccg gcggcgtcga ccgcgtcgag       600
     ctggcgctgg cgcatctgga cgacaactca cggaggggtc gtaccgatac cccgcacacg       660
     ccattgctgg cgggcctgcc tccgttggca gccgacggtg aggttgcgat cgtggaattc       720
     agtgcccgcc gcccgtttca cccgcaacgt ctgcatgccg cggttgacct gctgctcgat       780
     ggcgtggttc gcactcgagg tcggctgtgg ctggccaacc ggccggatca ggtcatgtgg       840
     ctcgaatcag ccggtggcgg tctgcgggtc gcatcggccg gaaagtggtt ggcggcgatg       900
     gcggcctcgg aggtggccta tgtcgacctg gagcggcggt tgttcgccga cctgatgtgg       960
     gtctacccgt tcggagaccg gcacaccgcg atgacggtac tggtatgcgg cgccgatccg      1020
     accgacatcg tcaatgccct gaacgcggcg ctgctcagcg acgacgaaat ggcatctccg      1080
     caacgctggc agtcctacgt cgaccctttc ggcgactggc atgacgaccc gtgccacgaa      1140
     atgcccgatg cggctgggga attctcggca caccgcaact caggagaatc tcgatga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page