(data stored in ACNUC7421 zone)

EMBL: CP001658.PE12

CP001658.PE12        Location/Qualifiers
FT   CDS_pept        14191..14979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00012"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23033"
FT                   /protein_id="ACT23033.1"
FT                   /translation="MRLTHPTPCPENGETMIDRRRSAWRFSVPLVCLLAGLLLAATHGV
FT                   SGGTEIRRSNAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSA
FT                   KLAGVAAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGA
FT                   EAIQMQDQRIIAMSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTLYK
FT                   QYVVRFGLGYREEVHPDLQIVGYADPVRMHFAQPAGPLDY"
     atgagactaa cccacccaac accctgcccg gaaaacggag agaccatgat tgatcggcgc        60
     cgatcggcgt ggcgtttcag tgtcccctta gtgtgcttgc tggcggggct gctgctggcc       120
     gccacgcatg gggtgtcggg cggcaccgag atccgccgca gcaatgcgcc gcgactggtc       180
     gaccttgtcc gtcgggcgca ggcatcggtg aaccgtctcg ccaccgaacg cgaagcgctg       240
     accaccagaa tcgactcggt gcacggccga tctgtcgata ccgcgttggc ggccatgcag       300
     cggcggtccg ccaagctggc cggtgtggcg gctatgaatc cggtccatgg gccgggcctg       360
     gtggttaccc tgcaagacgc gcaacgcgac gccaacggcc ggtttccgcg cgacgcgtcc       420
     ccggacgatc tggttgtgca tcagcaagac atcgaggctg tcctcaacgc gttgtggaat       480
     gccggtgctg aggcgatcca gatgcaggac cagcgcatca tcgcgatgtc gatagctcgt       540
     tgtgtcggaa acacgttgct gctcaacggg cgtacctata gcccgcccta cacgatcgcc       600
     gcgatcggag acgccgccgc catgcaggct gctctggctg cggctcccct ggtgacgctc       660
     tacaagcagt acgtggtccg gttcggcctc gggtaccgcg aagaagtcca tcctgacttg       720
     cagatagtcg gctatgccga tcccgtccgg atgcacttcg cgcagcctgc aggccccttg       780
     gactactga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page