(data stored in ACNUC7421 zone)

EMBL: CP001658.PE125

CP001658.PE125       Location/Qualifiers
FT   CDS_pept        148624..148992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23146"
FT                   /protein_id="ACT23146.1"
FT                   /translation="MAGSVSAAAGIGWVGLNVTETNRDQCYRVERTTVDALTHPEYRVH
FT                   TRGVQRVRVTRNARKHRVSKHRIVAAMRHCGVPVIQEDGSLYYQGRDTSGRLTEVVAVE
FT                   ADDGDLIITHAMPKEWKR"
     ttggccgggt cggtctcggc cgccgcagga atcggttggg tcggtttgaa cgtgacagag        60
     acgaacagag accagtgcta tcgcgtcgaa cggacgaccg ttgacgcttt gacacatccc       120
     gagtatcgag tacatactcg aggcgtgcag cgggtcaggg tcacgaggaa cgcccggaag       180
     caccgcgtgt ccaagcaccg catcgtcgcc gctatgcgcc actgcggtgt tccggtcatt       240
     caggaagatg gctcgctgta ctaccagggc cgcgatacgt cgggccgtct taccgaggtc       300
     gtcgccgtcg aagccgacga cggtgacctg atcatcactc acgcaatgcc gaaggagtgg       360
     aagcgatga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page