(data stored in ACNUC7421 zone)

EMBL: CP001658.PE131

CP001658.PE131       Location/Qualifiers
FT   CDS_pept        154493..155860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23152"
FT                   /db_xref="GOA:C6DQZ2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DQZ2"
FT                   /protein_id="ACT23152.1"
FT                   /translation="MTRSDTLATKLPWSDWLPRQRWYAGRNRELATVKPGVVVALRHNL
FT                   DLVLVDVTYTDGATERYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGPQFLL
FT                   SLIVSSAVCGTSTGEVTFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVS
FT                   SGINPDIELNRVLTRAGNPHVARLLGAYQFGRPNRSPTDALAYALGMVTEYEANAAEGW
FT                   AMATASVRDLFAEGDLYAHEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRM
FT                   LARLSSTVAVVPELREYAPTIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDF
FT                   EGEPGQPLDERRAPDSPLRDVAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAA
FT                   FCDGYAVASGIDPRDSALLLGAYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS"
     atgactcggt cggacacgct ggcaaccaag ctgccatggt ccgattggct tccgcggcaa        60
     cgttggtatg ccggacgcaa ccgcgagctg gccacggtca agccgggcgt agtcgtcgcc       120
     ctgcgacaca acctcgacct agtcctggtc gacgtaacct acaccgacgg tgcaacggag       180
     cgttaccagg tgctcgtcgg atgggatttt gagccggcgt ccgagtacgg cacgaaagcc       240
     gccatcggcg tcgccgacga tcgcacggga ttcgatgctc tctacgacgt cgccgggccg       300
     caattcctcc tgtcgctaat cgtctcgtcc gccgtctgtg gcacatccac cggcgaagta       360
     acgttcacca gggagccaga cgtcgagctg ccctttgccg cgcagccgcg ggtatgtgac       420
     gccgaacaga gcaacaccag tgtgatcttc gatcggcggg ctatcctcaa ggtgttccgc       480
     cgggtaagca gcgggatcaa ccccgacata gagctgaacc gcgtgcttac ccgtgccggt       540
     aatccacatg tggcccgcct gctgggcgct taccagtttg ggcggcccaa tcgttcgcca       600
     accgatgctc tggcgtacgc cctgggcatg gtgaccgagt atgaggcgaa cgcggccgaa       660
     ggctgggcga tggccaccgc cagcgtgcgg gacctcttcg ccgagggaga cctctatgcc       720
     cacgaagtcg gcggcgattt cgccggtgaa tcctaccggc tcggcgaggc ggtcgcctcg       780
     gtgcacgcca cgctggctga cagcctcgga accgcgcagg caacgttccc ggtggaccgg       840
     atgctggcgc ggctgtcgtc gacggtggcg gtggtgcccg aactgcggga gtacgcgcca       900
     acgatcgaac agcaattcca gaagctcgcg gcggaggcaa tcacggtcca gcgggtgcac       960
     ggtgacctgc acttgggaca ggtgctgcgt accccggaaa gctggctgtt gatcgacttt      1020
     gaaggcgagc cgggccagcc gctggacgaa cggcgagcgc cggattcgcc gctgcgcgac      1080
     gtggccggtg tgttgcgatc gttcgagtac gccgcttacg ggccgctggt ggaccaggcc      1140
     accgacaaac aacttgccgc tcgcgcccgc gaatgggtcg agcgcaatcg cgccgccttc      1200
     tgcgacggct acgcggtcgc gtcgggaatc gacccgcgag attcggcgct gctgttgggc      1260
     gcctacgaac tcgacaaggc ggtttatgag accggctatg agacacggca ccggccgggt      1320
     tggcttccga ttccgctgcg ttcgatcgcc cgcctgaccg ctagctga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page