(data stored in ACNUC7421 zone)

EMBL: CP001658.PE142

CP001658.PE142       Location/Qualifiers
FT   CDS_pept        165584..166087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23163"
FT                   /protein_id="ACT23163.1"
FT                   /translation="MSASEFSRAELAAAFEKFEKTVARAAATRDWDCWVQHYTPDVEYI
FT                   EHAAGIMRGRQRVRAWIQETMTTFPGSHMVAFPSLWSVIDESTGRIICELDNPMLDPGD
FT                   GSVISATNISIITYAGNGQWCRQEDIYNPLRFLRAAMKWCRKAQELGTLDEDAARWMRR
FT                   HGGP"
     gtgagcgctt cggagttctc ccgtgctgaa ctcgccgccg ccttcgagaa gttcgagaag        60
     accgtggccc gcgccgccgc gacgcgcgac tgggattgct gggtgcagca ctacaccccc       120
     gacgtcgaat acatcgagca cgcggcgggc atcatgcgag gccgccagcg ggtacgtgcc       180
     tggattcaag aaacgatgac gaccttcccg ggcagtcaca tggtggcctt cccgtcgctg       240
     tggtcggtga tcgacgagtc caccgggcga attatctgcg aattggacaa ccccatgctc       300
     gaccccggcg acggcagcgt gatcagcgcg acgaacattt cgatcatcac ctatgccggc       360
     aatggccagt ggtgccgtca agaagacatc tacaacccgt tgcggttcct gcgggcggcg       420
     atgaagtggt gtcgcaaggc gcaggagttg ggcaccctcg acgaggacgc ggcgcgttgg       480
     atgcgccggc atggaggtcc ttaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page