(data stored in ACNUC7421 zone)

EMBL: CP001658.PE145

CP001658.PE145       Location/Qualifiers
FT   CDS_pept        complement(167532..167942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23166"
FT                   /protein_id="ACT23166.1"
FT                   /translation="MTPFDDPQAELAWMFLQSLCEGGDLDEGFALLSNDFTYWSIVTRT
FT                   ELDKKTFRRAVERRKQVFEVNIELIRCVNEGETVVVEGHCDGVSADRTRYDSPFVCIFE
FT                   TRDGMIISLREYSDTQSLAEVYPVACATPGRC"
     atgacgccgt tcgacgaccc gcaagccgaa ctggcctgga tgttcctgca aagcctctgc        60
     gagggcggag atctcgacga aggcttcgcg ctgctcagca acgacttcac ctactggagc       120
     atcgtcaccc gtacggaatt ggacaagaag acgtttcggc gagcagtcga gcggcgcaag       180
     caggtcttcg aggtcaacat cgaactcatc cgctgcgtca acgagggtga aacggtagtg       240
     gtcgaggggc attgcgacgg tgtgagcgcc gaccggaccc gatatgacag cccgttcgtc       300
     tgcatcttcg agacccgtga cgggatgatc atctcgctgc gcgaatacag cgacacccag       360
     tcgttggccg aggtataccc ggtagcctgc gctaccccgg gaagatgctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page