(data stored in ACNUC7421 zone)

EMBL: CP001658.PE147

CP001658.PE147       Location/Qualifiers
FT   CDS_pept        complement(168965..170443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00144"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23168"
FT                   /protein_id="ACT23168.1"
FT                   /translation="MAPGDWSVFAWHAANLPTMPEAEDIGNEAAGGRFGVSIRSAGYLR
FT                   KWFLLGITIGVIAGLGAVVFYLALKYTSEFLLGYLADYQIPTPVGEGGHRGSTGFARPW
FT                   AIPLVTTGGAVLSALIVAKLAPEATGHGTDEAIESVHGDPRAIRGRAVLVKMVASALTI
FT                   GSGGSGGREGPTAQISAGFCSLLTRRLNLSNEDGRTAVALGIGAGIGAIFAAPLGGAAL
FT                   GASIPYRDDFDYRNLLPGFIASGTAYAVLGAFLGFDPLFGYIDAEYRFEKAWPLLWFVV
FT                   IGLIAAAVGYLYARVFHASVAITRRLPGGPVLKPAIGGLLVGLLGLPIPQILSSGYGWA
FT                   QLAADRGTLLSIPLWIVIVLPIAKILATSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLG
FT                   ELTELPGVPHEPGIFVVVAMMACFGSVSRAPLAVMIMVAEMTGSFSVVPGAIIAVGIAA
FT                   LLLSRTNVTIYETQRLNRQTAEAERGGSDRPTTA"
     atggcgccgg gcgactggtc ggtgttcgct tggcatgctg ctaacctccc gaccatgccg        60
     gaggcggaag acatcgggaa cgaggccgcc ggcggacgat tcggcgtatc gatcaggagc       120
     gcgggctacc tgcgcaaatg gttcctgcta ggcatcacga tcggtgtcat tgccggcctg       180
     ggcgccgtcg tcttctacct cgcgctgaaa tacaccagcg agtttctgct cggctacctc       240
     gcggactatc agattcccac tcccgttggg gagggcggcc accgcgggtc caccggtttc       300
     gcgcgtccgt gggcgattcc gctggtgacg acgggcgggg cggtgctgtc ggcattgatc       360
     gtggccaagc tcgccccgga ggccaccggt cacggcaccg acgaagcgat cgagtcggtg       420
     cacggcgatc cgcgcgccat ccgaggtcgg gcggtgctgg tgaagatggt ggccagcgcc       480
     ttgaccatcg gctcgggcgg ttcaggcggc cgcgaaggcc cgaccgcgca gatctcggcc       540
     ggcttctgct cactgctgac ccgccggctg aacctgtcca acgaagacgg ccggaccgcg       600
     gtagcgctgg gtatcggcgc cggcatcggc gccatcttcg ctgcgccact gggcggagcg       660
     gcgttgggcg cctcgatccc ctaccgcgac gacttcgact accgcaacct gctgccgggt       720
     ttcatcgcct cgggaaccgc ctacgccgtg ctcggcgcct tcttgggctt cgacccgctg       780
     ttcggctaca tcgacgccga gtatcgcttc gaaaaggcgt ggccactact gtggttcgtg       840
     gtgatcgggc tgatcgcagc cgccgtaggc tacttgtatg cccgagtctt tcacgcgtcg       900
     gtggcaatta cgcgccggct gcccgggggc ccggtgctca aaccggcgat cggcggactg       960
     ctggtcgggc tgttaggtct gccgattccc cagatcctga gcagcggcta tggctgggcg      1020
     cagctagccg ccgatcgggg gacgctgctg agcatcccgt tgtggatcgt catcgtcttg      1080
     ccgatcgcca agatcctcgc gacgtcgctg tcgatcggca ccggcggatc aggcgggcta      1140
     ttcgggccgg gaatcgtgat cggcgccttc gtcggagcgg cgatctggcg gctaggcgag      1200
     ctcaccgagc tgcccggggt gccccacgag ccgggcatct tcgtcgtggt cgcaatgatg      1260
     gcgtgcttcg gcagtgtctc ccgcgcgccg ctggccgtca tgatcatggt cgctgagatg      1320
     accggctcgt tctcggtggt gcctggagcg atcatcgccg tcggtatcgc ggcactgttg      1380
     ttgtctcgca ccaacgtcac catctacgag acgcagcgac tgaaccggca gaccgccgag      1440
     gccgaacgcg gaggcagtga tcggccgaca acggcttag                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page