(data stored in ACNUC7421 zone)

EMBL: CP001658.PE162

CP001658.PE162       Location/Qualifiers
FT   CDS_pept        184662..184994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00157"
FT                   /product="NAD(P) transhydrogenase alpha subunit pntAb"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23183"
FT                   /protein_id="ACT23183.1"
FT                   /translation="MYNELLENLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIV
FT                   VLGALVVFGEIEHPSLVLQVILFVAVVFGTLNVIGGFIVTDRMLGMFKAKKPAVPAKPD
FT                   RDEALR"
     atgtacaacg aattgttgga gaacctggcg atcctggtgc tgtccggatt cgtcgggttc        60
     gcggtgatct cgaaagtgcc caacacgttg cacaccccgc tgatgtcagg aaccaacgcc       120
     atccacggca ttgtcgttct cggcgcgctg gtggttttcg gcgaaattga gcacccatcg       180
     ctcgtgttgc aggtcatcct gttcgtcgcg gtggtgttcg gcacgctgaa cgtcatcggc       240
     ggattcatcg tcaccgaccg aatgctcggc atgttcaagg ccaagaagcc cgccgtgcca       300
     gccaagcccg accgcgacga ggcgctccga tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page