(data stored in ACNUC7421 zone)

EMBL: CP001658.PE163

CP001658.PE163       Location/Qualifiers
FT   CDS_pept        184991..186418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00158"
FT                   /product="NAD(P) transhydrogenase beta subunit pntB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23184"
FT                   /protein_id="ACT23184.1"
FT                   /translation="MNLHYLVEILYIISFSLFIYGLMGLTGPKTAVRGNLIAAAGMTIA
FT                   VAATLVMIRHTSQWPLIIAGLVVGVVLGVPPARLTKMTAMPQLVAFFNGVGGGTVALIA
FT                   LSEFIDTTGFSAFQHGESPTVHIVVASLFAAIIGSISFWGSIVAFGKLQEIISGRPIGL
FT                   GKAQQPINLLLLAVAVAAAVVIGLHAHPGSGGVALWWMIGLLVAAGVLGLMVVLPIGGA
FT                   DMPVVISMLNAMTGLSAAAAGLALNNTAMIVAGMIVGASGSILTNLMAKAMNRSIPAIV
FT                   AGGFGGGGVAPSGGGDDKHVKATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDLA
FT                   TLLEDRGVPVKYAIHPVAGRMPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVTIVIG
FT                   ANDVTNPAARNETSSPIYGMPILNVDKSRSVIVLKRSMNSGFAGIDNPLFYADGTTMLF
FT                   GDAKKSVTEVSEELKAL"
     atgaacctgc actacctggt cgagattctc tacatcatct ccttttcact cttcatctac        60
     gggttgatgg ggctcaccgg ccccaagacc gcggtgcgcg ggaacctgat cgccgcggcc       120
     ggcatgacca tcgccgtggc ggccacgttg gtcatgatcc gacacaccag ccaatggccg       180
     ctgatcatcg ccggtctggt ggtgggtgtt gtgctcggtg tgccgccggc gcgactgacc       240
     aagatgaccg ccatgccgca gctggtggca ttcttcaacg gcgtgggcgg aggaacggtc       300
     gcactcatcg cgctgtcgga gttcatcgat accaccggct tttccgcatt ccagcacggc       360
     gagtcgccga ccgtgcacat cgtggtggcc tcattgttcg ccgcgatcat cgggtcgatc       420
     tcgttctggg ggtctatcgt cgcgttcggc aagttgcagg agatcatctc cgggcggccg       480
     atcggactcg gcaaggcgca gcagccgatc aacctgttgc tgctggccgt ggccgtggcc       540
     gccgccgtgg tgatcggact gcacgcgcat cccgggagcg gtggggtcgc attgtggtgg       600
     atgatcggcc tgttggtcgc cgccggcgtg ctgggtctga tggtggtgtt gccgatcggt       660
     ggcgccgaca tgccggtggt catctcgatg ctcaacgcca tgaccggcct gtcggccgcg       720
     gcggcgggtc tggcgttgaa caacaccgcg atgatcgtgg ccggcatgat cgtcggcgcg       780
     tccggctcga tcctgaccaa cctgatggct aaggcgatga accgctccat tccggcgatc       840
     gtcgcgggcg gtttcggcgg cggcggtgtg gcgcccagtg gcggcggcga cgacaaacac       900
     gtcaaggcca cttcggccgc cgatgccgcg atccagatgg catacgccaa tcaggtgatc       960
     gtggtgcccg gctacgggtt ggccgtcgcg caggcgcagc atgcggtgaa ggacctggca      1020
     accttgctgg aggacagggg tgtgccggtc aagtacgcga ttcacccggt cgccggccgg      1080
     atgcccgggc atatgaacgt gctgctggcc gaggccgaag tcgactacga cgcgatgaag      1140
     gacatggacg acatcaacga cgagttcgcc cgcaccgacg tcaccatcgt gatcggcgcc      1200
     aacgacgtca ccaacccggc ggcccgcaac gagacgtcca gcccgatcta cggcatgccg      1260
     atcctcaacg tggacaagtc gaggtcggtg atcgtgctca aacggtcgat gaattccggg      1320
     ttcgccggca tcgacaaccc gctgttctac gccgacggca ccactatgtt gttcggtgat      1380
     gcgaagaaat cggtgaccga agtctccgag gaactcaagg cgttgtag                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page