(data stored in ACNUC7421 zone)

EMBL: CP001658.PE171

CP001658.PE171       Location/Qualifiers
FT   CDS_pept        193565..194050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23192"
FT                   /protein_id="ACT23192.1"
FT                   /translation="MTAISCSPRPRYASRMPVLSKTVEVTADAASIMAIVADIERYPEW
FT                   NEGVKGAWVLARYDDGRPSQVRLDTAVQGIEGTYIHAVYYPGENQIQTVMQQGELFAKQ
FT                   EQLFSVVATGAASLLTVDMDVQVTMPVPEPMVKMLLNNVLEHLAENLKQRAEQLAAS"
     atgacggcaa tctcgtgctc accgcgaccc aggtatgctt cccgaatgcc agttttgagc        60
     aagaccgtcg aggtcaccgc cgacgccgca tcgatcatgg ccatcgttgc cgatatcgag       120
     cgctacccag agtggaatga aggggtcaag ggcgcatggg tgctcgctcg ctacgatgac       180
     gggcgtccca gccaggtgcg gctcgacacc gctgttcaag gcatcgaggg cacctatatc       240
     cacgccgtgt actacccagg cgaaaaccag attcaaaccg tcatgcagca gggtgaactg       300
     tttgccaagc aggagcagct gttcagtgtg gtggcaaccg gcgccgcgag cttgctcacg       360
     gtggacatgg acgtccaggt caccatgccg gtgcccgagc cgatggtgaa gatgctgctc       420
     aacaacgtcc tggagcatct cgccgaaaat ctcaagcagc gcgccgagca gctggcggcc       480
     agctaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page