(data stored in ACNUC7421 zone)

EMBL: CP001658.PE176

CP001658.PE176       Location/Qualifiers
FT   CDS_pept        198473..199837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00170"
FT                   /product="MCE-family protein mce1A"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23197"
FT                   /protein_id="ACT23197.1"
FT                   /translation="MTTPGKLNKARVPPYKTAGLGLVLVFALVVALVYLQFRGEFTPKT
FT                   QLTMLSARAGLVMDPGSKVTYNGVEIGRVDTISEVTRDGESAAKFILDVDPRYIHLIPA
FT                   NVNADIKATTVFGGKYVSLTTPKNPTKRRITPKDVIDVRSVTTEINTLFQTLTSIAEKV
FT                   DPVKLNLTLSAAAEALTGLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQLAALGDVYA
FT                   DAAPDLFDFLDSSVTTARTINAQQAELDSALLAAAGFGNTTADVFDRGGPYLQRGVADL
FT                   VPTATLLDTYSPELFCTIRNFYDADPLAKAASGGGNGYSLRTNSEILSGIGISLLSPLA
FT                   LATNGAAIGIGLVAGLIAPPLAVAANLAGALPGIVGGAPNPYTYPENLPRVNARGGPGG
FT                   APGCWQPITRDLWPAPYLVMDTGASLAPYNHMEVGSPYAVEYVWGRQVGDNTINP"
     atgacgacgc cggggaagct gaacaaggcg cgagtgccgc cctacaagac ggcgggtttg        60
     ggtctagtgc tggtcttcgc gctcgtagtt gccttggtat acctgcagtt tcgcggggag       120
     ttcacgccca agacgcagtt gacgatgctg tccgctcgtg cgggtttggt gatggatccc       180
     gggtcgaagg tcacctataa cggggtggag atcgggcggg tagacaccat ctcggaggtc       240
     acacgtgacg gcgagtcggc ggccaagttc atcttggatg tggatccgcg ttacatccac       300
     ctgattccgg caaatgtgaa cgccgacatc aaggcgacca cggtgttcgg cggtaagtat       360
     gtgtcgttga ccacgccgaa aaacccgaca aagaggcgga taacgccaaa agacgtcatc       420
     gacgtacggt cggtgaccac cgagatcaac acgttgttcc agacgctcac ctcgatcgcc       480
     gagaaggtgg atccggtcaa gctgaacctg accctgagcg cggccgcgga ggcgttgacc       540
     gggctgggcg ataagttcgg cgagtcgatc gtcaacgcca acaccgttct ggatgacctc       600
     aattcgcgga tgccgcagtc gcgccacgac attcagcaat tggcggctct gggcgacgtc       660
     tacgccgacg cggcgccgga cctgttcgac tttctcgaca gttcggtgac caccgcccgc       720
     accatcaatg cccagcaagc ggaactggat tcggcgctgt tggcggcggc cgggttcggc       780
     aacaccacag ccgatgtctt cgaccgcggc gggccgtatc tgcagcgggg ggtcgccgac       840
     ctggtcccca ccgccaccct gctcgacact tatagcccgg aactgttctg cacgatccgc       900
     aacttctacg atgccgatcc gctcgctaaa gcggcgtccg gtggcggtaa cggctactcg       960
     ctgaggacga actcagagat cctatccggg ataggtatct ccttgttgtc tcccctggcg      1020
     ttagccacca atggggcggc aatcggaatc ggactggtag ccggattgat agcgccgccc      1080
     ctcgcggtgg ccgcaaatct agcgggagcc ctacccggaa tcgttggcgg cgcgcccaat      1140
     ccctatacct atccggagaa tctgccgcgg gtgaacgctc gcggtggccc ggggggcgcc      1200
     cccggttgct ggcagccgat cacccgggat ctgtggccag cgccgtatct ggtgatggac      1260
     accggtgcca gcctcgcccc gtacaaccac atggaggttg gctcgcctta tgcagtcgag      1320
     tacgtctggg gccgtcaggt aggggataac acgatcaacc catga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page