(data stored in ACNUC7421 zone)

EMBL: CP001658.PE178

CP001658.PE178       Location/Qualifiers
FT   CDS_pept        200913..202418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00172"
FT                   /product="MCE-family protein mce1C"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23199"
FT                   /protein_id="ACT23199.1"
FT                   /translation="MGIVVALLVVAVGQSFTSVPMLFAKPSYYGQFTDSGGLHKGDRVR
FT                   IAGLGVGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILGRKVLEIEPRGAQAL
FT                   PPGGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSETVDQTYPHLSAALD
FT                   GVAKFSDTIGKRDEQITHLLAQANQVASILGDRSEQVDRLLVNAKTLIAAFNERGRAVD
FT                   ALLGNISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLAETLTILGRFSASFG
FT                   ETFASGPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAGLPAYRWPDPNGTRF
FT                   PNGAPPPPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPLPCANLTQGPFGGPD
FT                   FPAPLDVATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQEAPPGARTLPLGPA
FT                   PGPAPPPAAPGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN"
     atgggcatcg tcgttgcgct gctcgttgtc gctgtgggcc aaagctttac cagtgttccc        60
     atgctattcg caaagccgag ctactacggc cagttcaccg actccggcgg actgcacaag       120
     ggcgacaggg tacgcatcgc cggcttggga gtgggcaccg tggaggggct caagatcgac       180
     ggcgaccaca tcgtggtcaa gttctccatc ggcaccaaca ccatcggcac cgagagccgc       240
     ctagccatcc gcaccgacac catcctgggt aggaaagtgc tcgagatcga gccgcgcggc       300
     gcccaagcgt tgccgcccgg gggcgttttg ccggttgggc aaagcaccac cccgtaccag       360
     atttacgacg cgttcttcga cgtcaccaag gccgcatccg gctgggacat cgagacggtc       420
     aagcggtcgc tgaatgtgtt gtcggagacc gttgatcaga cctatccgca cctgagcgcc       480
     gccctcgacg gggtggctaa gttctccgac accatcggca agcgcgacga gcagatcacg       540
     cacctactag cccaggccaa ccaggtggcc agcatcctgg gtgatcgcag tgagcaggtc       600
     gaccgcctat tggtcaacgc taagaccctg atcgccgcgt tcaacgagcg cggccgcgcg       660
     gtcgacgccc tgctggggaa catctccgct ttctcggccc aggtgcaaaa ccttatcaac       720
     gacaacccga acctgaacca tgtgctcgag cagctgcgca tcctcaccga cctgttggtc       780
     gaccgcaagg aggatttggc tgaaaccctg acgatcttgg gcagattcag cgcgtcgttc       840
     ggtgagacgt ttgcctctgg gccctacttc aaagtgctgc tggccaacct ggtgccgggt       900
     cagatcttgc agccgtttgt cgatgcggca ttcaagaagc gtggtattag cccggaggac       960
     ttctggcgca gcgccgggct gccggcatac cggtggcccg accccaatgg cacccggttc      1020
     cccaacggtg cgccgccgcc accaccgccg gtgttggagg gcacgcccga gcatcccggg      1080
     ccggcggtgc cgccgggatc gccgtgctcc tacaccccgc cggcggacgg tctgccgcgg      1140
     ccgtgggatc cgctgccctg cgctaacctc actcaaggtc cattcggtgg ccccgatttc      1200
     ccggcgccgc tggatgtcgc gacgtcgccg ccgaacccag acggtccacc gcccgccccg      1260
     ggcctaccaa tcgcgggacg tccgggtgag gtgccgccga acgttcccgg cacgccggtg      1320
     ccgattccac aggaggctcc ccccggggca cgcacgctgc ccctcgggcc ggcgcctggt      1380
     ccggctccgc ccccggcggc gccaggcccg ccggcaccac cgggccccgg gccgcagttg      1440
     ccggccccgt tcatcaaccc cggcggcacc ggcggtagtg gcgtgacggg aggtagcgag      1500
     aattga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page