(data stored in ACNUC7421 zone)

EMBL: CP001658.PE182

CP001658.PE182       Location/Qualifiers
FT   CDS_pept        206753..207394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00176"
FT                   /product="MCE-associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23203"
FT                   /protein_id="ACT23203.1"
FT                   /translation="MKAADSAESDAGADQTGPQVKAADSAESDAGELGEDACPEQALVE
FT                   RRPSRLRRGWLVGIAATLLALAGGLGAAGYFALRSHQESQSIAREDLAAIEAAKDCVAA
FT                   TQAPDAGAMSASMQKIIECGTGDFGAQASLYTSTLVEAYQAASVHVQVTDMRAAVERNN
FT                   NDGSVDVLVALRVKVSNTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK"
     gtgaaggcgg cggattcggc ggaatctgac gccggagccg accagactgg cccgcaggtg        60
     aaggcggcgg attcggcgga atctgacgcc ggagagctcg gcgaggacgc gtgcccagaa       120
     caggccctcg tcgagcggcg cccgtcgcgg ttgcggcgag gctggcttgt tggcattgcg       180
     gcgacgctgc tcgcgttggc cggtggcctt ggcgcagcgg gttattttgc gttgcgctca       240
     caccaggaaa gccaatcaat cgcgcgcgag gaccttgcgg ccattgaggc cgctaaggat       300
     tgcgttgcgg ccacgcaggc acccgatgct ggggcgatgt cggctagcat gcagaagatc       360
     atcgagtgtg gcaccggtga tttcggtgcc caggcgtcgt tgtacaccag cacgctcgtc       420
     gaggcgtatc aagcggccag cgtccacgtg caagtgaccg atatgcgcgc ggcggtcgag       480
     cgcaacaaca atgacgggtc ggtcgatgtt ctggtggcgc tccgggtcaa ggtgtccaac       540
     accgactcgg atgcccatga agtcggctac cgtcttcggg tccggatggc actggatgag       600
     ggccgctata agatcgccaa actcgaccag gtgacgaagt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page