(data stored in ACNUC7421 zone)

EMBL: CP001658.PE183

CP001658.PE183       Location/Qualifiers
FT   CDS_pept        207397..208359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00177"
FT                   /product="MCE-associated transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23204"
FT                   /protein_id="ACT23204.1"
FT                   /translation="MVVEKTPTTLPQATPNGAAPWHVRAGAFAIDVLPGLAVAATMALT
FT                   ALTVPPGSAWRWLCACLLGLTILLLAVNRLLLPTITGWSLGRALTGIRVVRRDGSAIGP
FT                   WRLLVRDLAHLVDTLSLFVGWLWPLWDSRRRTFADLLLRTEVRRVEPVQRPAVIRRLTA
FT                   AVALAAAGACASATAVGAAVVYVNEWQTDHTRAQLATRGPKLVVDVLSYDPETVQRDFE
FT                   RARSLATDRYRPQLSIQQDSVRESGPVRNQYWVTDSAVLSATPAQATMLLFMQGERGTP
FT                   PNQRYIQSTVRAIFQKSRGQWRLDDLAVVMKPRQPTGEK"
     gtggtggtcg agaagacgcc gaccaccctg ccccaggcga caccgaacgg tgcagcgccc        60
     tggcatgttc gggcgggcgc cttcgccatc gacgtgctgc ccgggctcgc cgtggcggcg       120
     accatggcgt tgacggcttt aacggtgccg ccgggcagcg cgtggcggtg gttatgcgct       180
     tgtctgctcg gattgaccat tctccttctg gccgttaacc ggttgttgtt gccgacgatt       240
     accggatgga gtcttggccg cgctcttacc ggcatccggg tggttcggcg tgacggctcc       300
     gccatcggtc cgtggcggtt gctggtccgg gatttggcgc acttggtgga caccctctcg       360
     ctgtttgtgg gttggctgtg gccgctgtgg gattcgcggc gacgcacctt cgccgacctg       420
     ttgttgcgca ctgaggtgcg acgtgtcgaa ccggtgcagc ggcccgcggt gatacggcga       480
     ctgacggcgg cggtggcatt ggcggcggcg ggcgcgtgcg cgagcgcaac cgcggtgggc       540
     gctgcggtgg tgtacgtcaa tgaatggcaa accgatcaca ctcgcgcgca gctcgcaacg       600
     cggggcccga agctcgtggt cgacgtcctg agctacgacc ccgaaacggt gcagcgtgat       660
     ttcgaacggg cgcgatcgct ggccaccgac aggtaccgcc cgcagctgag catccaacag       720
     gattcggtgc gcgagtcggg acctgttcgt aaccagtact gggttaccga cagcgcggtg       780
     ctgtcggcga caccagctca ggcgaccatg ctgttgttca tgcagggtga acgcggtaca       840
     ccacccaatc agcggtatat tcagtcaact gtgcgggcga tcttccaaaa atcgcgcggg       900
     caatggcgcc tcgacgatct ggcagtcgtg atgaaacccc gacaacccac cggcgaaaaa       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page