(data stored in ACNUC7421 zone)

EMBL: CP001658.PE21

CP001658.PE21        Location/Qualifiers
FT   CDS_pept        complement(26015..26980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23042"
FT                   /protein_id="ACT23042.1"
FT                   /translation="MLSTAFSQMFGIDYPIVSAPMDLIAGGELAAAVSGAGGLGLIGGG
FT                   YGDRDWLARQFDLAAGAPVGCGFITWSLARQPQLLDLALQYEPVAVMLSFGDPAVFADA
FT                   IKSAGTRLVCQIQNRTQAERALQVGADVLVAQGTEAGGHGHGPRSTLTLVPEIVDLVTA
FT                   RGTDIPVIAAGGIADGRGLAAALMLGAAGVLVGTRFYATVEALSTPQARDPLLAATGDD
FT                   MCRTTIYDQLRRYPWPQGHTMSVLSNALTDQFEDTELDILHREEAMARYWRAVAARDYS
FT                   IANVTAGQAAGLVNAVLPAADVITGMAQQAARTLTAMRAV"
     gtgctatcga cggcctttag ccagatgttc ggaatcgact atccgatagt gtccgcgcca        60
     atggacttga tcgccggcgg tgagctggct gccgcggtaa gtggcgcagg gggactcggc       120
     ctcatcgggg gcggctatgg ggaccgggat tggttggccc ggcagttcga tctcgccgct       180
     ggagcgccgg tgggctgcgg gttcatcacc tggtctttgg cccgccaacc gcagctgctc       240
     gacctcgcgc tgcagtatga gccggtggcg gtgatgctgt cgttcgggga ccccgcggtt       300
     ttcgctgacg ccatcaagtc cgccggaacg cggttggtct gccagatcca aaaccggacc       360
     caggccgagc gagccctgca ggtcggcgcc gatgtgttgg tggctcaggg caccgaggcc       420
     ggtgggcacg gccacggtcc acgttccacc ctgaccttgg tacccgaaat cgtcgacctg       480
     gtcaccgcgc ggggaactga tatcccggtg atcgccgccg ggggcatcgc cgacggccgg       540
     ggccttgccg ccgcgttgat gttgggcgcc gccggggtat tggtcggtac gcgcttctac       600
     gccacggtcg aagcgttatc cacaccgcag gcgcgggacc cgctgctggc ggccactggc       660
     gacgacatgt gccgcaccac tatctacgat cagctacggc gctatccctg gccgcaagga       720
     cacacgatga gcgtgctaag caacgccctc accgaccaat tcgaggacac cgaactcgac       780
     attctccatc gcgaagaagc catggccaga tattggcgag ccgttgctgc gcgtgactac       840
     agcatcgcca atgtcaccgc cggtcaagcc gcgggcctgg tcaatgccgt cctgccagcc       900
     gccgacgtga taaccggtat ggcgcaacaa gcggcgagga cgctgaccgc gatgcgcgcc       960
     gtgtaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page