(data stored in ACNUC7421 zone)

EMBL: CP001658.PE214

CP001658.PE214       Location/Qualifiers
FT   CDS_pept        complement(247325..248059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23235"
FT                   /protein_id="ACT23235.1"
FT                   /translation="MMMSLTEDVTSQTSESLARHSVLAEDLSQDGLTSLGAPGARVLLV
FT                   WDAPNLDMGLGSILGRRPTALERPRFDALGRWLLARTAEIVAGRPGISTEPEATVFTNI
FT                   APGSAEVVRPWVDALRNVGFAVFAKPKVDEDSDVDRDMLAHIDERYREGLAALVVASAD
FT                   GQAFRQPLEAVARSGTPVQVLGFREHASWALASDTLEFVDLEDIAGVFREPLPRIGLDS
FT                   LPEQGAWLQPFRPLSSLLTSRV"
     atgatgatga gcctgaccga agacgtgact tcacaaacat ctgaatccct cgcccggcac        60
     tcggtactgg cggaagactt atcgcaggac gggctgacca gtctcggtgc gccgggggca       120
     cgggtattgc tggtgtggga cgctcccaac ctcgacatgg gtttgggctc catcttgggc       180
     cgccggccga cagcactgga acgaccacga ttcgacgccc tgggacgctg gctgctggcc       240
     cgaaccgcag agattgtggc cggccgtcca ggcatctcga ccgaaccgga ggccaccgtc       300
     ttcaccaaca tcgcccctgg cagcgccgag gtggtccggc cgtgggtgga cgcgttgcgc       360
     aatgtcggat tcgccgtctt cgccaaaccg aaagtagacg aggacagcga cgttgaccgc       420
     gacatgttgg cgcacatcga cgagcgctac cgcgaagggc tcgccgcgct ggtggtggcg       480
     tcggccgacg gtcaggcatt ccgccaaccg ttggaggcgg tcgcccgcag cggaacccca       540
     gttcaagtgc tcggatttcg tgaacacgcc agttgggcgc tagcgtcgga taccttggag       600
     ttcgtcgacc tggaggacat cgctggtgtt ttccgggaac cactacctcg aatcggcctc       660
     gattcgctac ctgagcaggg ggcttggctg cagccgttcc ggccgctgtc ctcgctgttg       720
     acctcgcgag tgtga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page