(data stored in ACNUC7421 zone)

EMBL: CP001658.PE225

CP001658.PE225       Location/Qualifiers
FT   CDS_pept        260865..262193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00219"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23246"
FT                   /protein_id="ACT23246.1"
FT                   /translation="MSDPARGAEAEDAYGFPAGLWRWLQRHPPPALHRLTRFRSPLRGP
FT                   WLTSVFGLVLLVALPFVIITGLLSYIAYAPQLGQAIPGDVGWLRLPAFTWPTRPSWLYR
FT                   LTQGLHVGLGLVIIPVVLAKLWSVIPRLFVWPPARSIAQVLERLSVLMLVGGILFQIVT
FT                   GVLNIQYDYIFGFSFYTGHYFGAWVFIAGFLLHIVVKIPHMVTGLRSIPMREVLGTNVA
FT                   DTRAQPCDPDGLVSVNPGEATLSRRGALGLVGAGVLLIGVLTVGQTLGGFTRKAALLLP
FT                   RGRVVSPGDFPVNKTAAAAGITAEAIGPDWRLVLRGGPAEVVLDRATLAGLPQRTARLP
FT                   LACVEGWSAVRTWSGVPLAELALLAGVPAARSARVTSLQRGGAFGEAKLAANQIADPDA
FT                   LLALRVDGADLSLDHGYPARIIVPALPGVHNTKWVAGIEFHKR"
     atgagtgatc cagcaagagg ggcggaagcc gaggatgcct acggttttcc cgccgggctg        60
     tggcgctggc tgcagcggca tccaccgccg gcgttgcacc ggctcacccg gtttcgcagc       120
     ccgttgcgtg gtccgtggtt gacgtcggtg ttcggcctgg tgctattggt ggcgttgcct       180
     ttcgtcatca tcaccgggct actttcttat atcgcctatg cgccgcagct gggccaggcc       240
     atccccggtg acgtcggctg gctgcgactc cccgctttca cctggcccac ccgtccgtcc       300
     tggctgtacc ggttgaccca ggggctgcat gtggggctgg ggctggtgat cattcccgtg       360
     gtgctggcca agttgtggtc ggtgataccg cggctgtttg tgtggccgcc ggcgcgctcg       420
     attgcccagg tgctcgaacg gttgtcggtg ctgatgctgg tcggtgggat cctgttccag       480
     atcgtcaccg gcgtgctcaa cattcagtat gactacatct tcgggttcag cttctacacc       540
     ggccactatt ttggggcttg ggtcttcatt gcgggtttcc tgttgcatat cgtggtcaag       600
     atcccccaca tggtcaccgg gttgcgatcg ataccgatgc gagaagtgtt gggtaccaac       660
     gtggctgaca cccgggcgca gccgtgcgat ccggacgggc tggtgtcggt caatccgggc       720
     gaggccacgc taagcagacg cggtgccctg ggattggtcg gtgccggggt gctgctgatc       780
     ggggtgctga cggttgggca aaccctgggc gggttcaccc gcaaggccgc cctgctgctg       840
     ccccggggcc gtgtcgtgag cccgggcgac ttcccggtca acaagaccgc cgccgccgcc       900
     gggatcaccg cggaggccat tggccccgac tggcggctgg tgctgcgtgg cgggcctgcg       960
     gaagtagtgc tggatcgcgc cacgctggcc ggcctgccgc aacgcaccgc ccggctgccg      1020
     ctggcctgcg tcgaagggtg gtcggccgtg cgcacctgga gcggcgtgcc gctggccgag      1080
     ctggcgctgc tggcgggcgt gccggcggcg cgctcggcac gggttacatc gctgcagcgc      1140
     ggcggggcgt tcggcgaggc gaagctggcg gcaaaccaga tcgccgaccc cgatgcgctg      1200
     ctggcgttgc gggtcgacgg ggcggatctg tcgctggatc atggctaccc ggcccgcatc      1260
     atcgttcccg cactgcccgg tgtgcacaac acgaaatggg tcgctggcat cgaattccac      1320
     aagaggtga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page