(data stored in ACNUC7421 zone)

EMBL: CP001658.PE244

CP001658.PE244       Location/Qualifiers
FT   CDS_pept        complement(282590..286792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00237"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23265"
FT                   /protein_id="ACT23265.1"
FT                   /translation="MAPLSRKWLPVVGAVALALTFAQSPGQVSPDTKLDLTANPLRFLA
FT                   RATNLWNSDLPFGQAQNQAYGYLFPHGTFFVIGHLLGVPGWVTQRLWWAVLLTVGFWGL
FT                   LRVAEALGVGGPSSRVVGAVAFALSPRVLTTLGSISSETLPMMLAPWVLLPTILALRGT
FT                   SGRSVRALAAQAGLAVALMGAVNAIATLAGCLPAVIWWACHRPNRLWWRYTAWWLLAMA
FT                   LATLWWVMALTQLHGVSPPFLDFIESSGVTTQWSSLVEVLRGTDSWTPFVAPNATAGAP
FT                   LVTGSAAILGTCLVAAAGLAGLTSPAMPARGRLVTMLLVGVVLLAVGHRGGLASPVAHP
FT                   VQAFLDAAGTPLRNVHKVGPVIRLPLVLGLAQLLSRVPLPGSAPRPAWLRAFAHPERDK
FT                   RVAVAVVALTALMVSTSLAWTGRVAPPGTFGALPQYWQEAADWLRTHHAATPTPGRVLV
FT                   VPGAPFATQVWGTSHDEPLQVLGDGPWGVRDSIPLTPPQTIRALDSVQRLFAAGRPSAG
FT                   LADTLARQGISYVLVRNDLDPETSRSARPILLHRSIAGSPGLAKLAEFGAPVGPDPLAG
FT                   FVNDSGLRPRYPAIEIYRVSAPANPGAPYFAATDQLARVDGGPEVLLRLDERRRLQGQP
FT                   PLGPVLMTADARAAGLPVPQVAVTDTPVARETDYGRVDHHSSAIRAPGDARHTYNRVPD
FT                   YPVPGAEPVVGGWTGGRITVSSSSADATAMPDVAPASAPAAAVDGDPATAWVSNALQAA
FT                   VGQWLQVDFDRPVTNAVVTLTPSATAVGAQVRRILIETVNGSTTLRFDEAGKPLTAALP
FT                   YGETPWVRFTAAATDDGSAGVQFGITDLAITQYDASGFAHPVQLRHTVLVPGPPPGSAI
FT                   AGWDLGSELLGRPGCAPGPDGVRCAASMALAPEEPANLSRTLTVPRPVSVTPMVWVRPR
FT                   QGPKLADLIAAPSTTRASGDSDLVDILGSAYAAADGDPATAWTAPQRVVQHKTPPTLTL
FT                   TLPRPTVVTGLRLAASRSMLPAHPTVVAINLGDGPQVRQLQVGELTTLWLHPRVTDTVS
FT                   VSLLDWDDVIDRNALGFDQLKPPGLAEVVVLGAGGAPIAPADAARNRARALTVDCDHGP
FT                   VVAVAGRFVHTSIRTTVGALLDGEPVAALPCEREPIALPAGQQELLISPGAAFVVDGAQ
FT                   LSTPGAGLSSATVTSAETGAWGPTHREVRVPESATSRVLVVPESINSGWVARTSTGARL
FT                   TPIAVNGWQQAWVVPAGNPGTITLTFAPNSLYRASLAIGLALLPLLALLAFWRTGRRQL
FT                   ADRPTPPWRPGAWAAAGVLAAGAVIASIAGVMVMGTALGVRYALRRRERLRDRVTVGLA
FT                   AGGLILAGAALSRHPWRSVDGYAGNWASVQLLALISVSVVAASVVATSESRGQDRMQ"
     gtggcgccgt tgtctcgcaa atggctgccg gtggtcggcg cggtagcgtt ggcgctgacg        60
     ttcgcccaat cccccggaca agtctccccc gacaccaagc tggacctcac cgccaacccg       120
     ctgcgcttcc tggcgcgtgc gaccaacctg tggaacagcg acctgccgtt cgggcaggcg       180
     cagaaccagg cctacgggta tctgtttccg cacggcacct tcttcgtgat cggtcacctg       240
     ctgggagtgc ccggctgggt cactcagcgg ctgtggtggg cggtgttgct cacggtcggc       300
     ttctggggcc tgctgcgggt agccgaggcg ctgggcgtcg gcggcccgtc ctcgcgggtg       360
     gtcggcgccg tggcgttcgc gctgtcacca cgggtgctga ccacactcgg gtcgatctcg       420
     tcggaaacct tgccgatgat gctggcgccg tgggtgctgc tgcccacgat cctggcgctg       480
     cgggggactt ctggccgctc ggtgcgcgcg ctggccgccc aagccgggct ggcggtggcg       540
     ctgatgggcg cggtcaacgc catcgcgacg ctggccggtt gcctgccggc ggtgatctgg       600
     tgggcctgtc accggccgaa tcggttgtgg tggcgctaca ccgcgtggtg gctgttggcg       660
     atggccctgg cgacactgtg gtgggtaatg gcgctgacgc agctgcacgg ggtcagtccg       720
     ccgtttctgg acttcatcga atcttccggc gtgaccacgc aatggtcctc gctggtggag       780
     gtgctgcgcg gcaccgacag ctggacgccg ttcgtggcgc cgaacgcgac cgcgggcgcg       840
     ccgttggtca ccggatcggc ggccatcctg ggcacctgcc tggtcgcagc ggccgggctg       900
     gccggactga ctagcccggc gatgccggcg cgcggccggc tggtgacgat gctgttggtc       960
     ggggtggtgc tgctggccgt cggccaccgc ggcgggctgg cttcgccggt cgcccacccg      1020
     gtgcaggcgt tcctggacgc cgccggcacc cccctgcgca acgtacacaa ggtggggccg      1080
     gtgatccggc tgcccctggt gctgggcttg gcgcagctgc tgagccgagt tccgctgcca      1140
     ggcagcgcgc cgaggccggc gtggctgcgc gcgttcgcgc accccgagcg ggacaagcga      1200
     gtagcggtgg cggtggtagc cctgaccgcg ctgatggtca gcacctcgct ggcgtggacc      1260
     ggccgggtcg ccccgcccgg cacgttcggt gcgcttcccc agtactggca ggaggccgcc      1320
     gactggctgc gcacacacca tgccgcgacg cccactcccg ggcgggtgct ggtggtcccg      1380
     ggcgccccgt tcgccaccca ggtgtggggc accagccacg acgagccgct gcaggtgctc      1440
     ggcgacggcc cgtggggcgt gcgcgactcc attccgctga ccccgccgca gaccattcga      1500
     gcgctggact ccgtgcaacg cctgttcgcc gccggacgac cgtcggcggg gctggccgat      1560
     acccttgccc gccaaggcat ttcctatgtg ctggtacgca acgatctgga tcccgagacg      1620
     tcgcgctcgg cacgaccgat tctgctgcac cgtagcatcg cagggtcgcc cgggctagcg      1680
     aagctggcgg agttcggcgc gccggtgggt cctgatccgc tggcgggttt cgtcaacgac      1740
     agcggcctgc gaccccgata tcccgcgatt gagatctacc gggtgagcgc gcccgccaac      1800
     cccggtgcgc cctacttcgc cgcgaccgac cagctcgccc gcgtcgacgg cggacccgag      1860
     gtcctgctgc gtctggacga acgacgccgg ctgcagggcc agcccccgct gggtccggtg      1920
     ctgatgaccg cggacgctcg agctgccggc ttgccggtgc cccaggtcgc cgtcaccgac      1980
     accccggtgg cccgcgagac cgattacggc cgggtggacc accactcgtc ggcgatccgg      2040
     gcacccggcg acgcccggca cacctacaac cgggtgcctg actacccggt gccgggcgcg      2100
     gagccggtcg tcggtggatg gaccggcggc cggatcaccg tgtcgagctc ctcggcggat      2160
     gccaccgcca tgcccgacgt cgccccggcg agcgcacccg cggccgccgt cgacggtgac      2220
     ccggcgaccg cttgggtgtc caacgcgctg caggccgccg ttgggcagtg gctgcaggtg      2280
     gatttcgacc gtccggtgac caatgccgtc gtcaccctga cacccagcgc gaccgcggtc      2340
     ggcgcccagg tccgacgcat cctgatcgag accgtcaacg gcagcaccac cctgcggttc      2400
     gatgaggcgg gcaaaccgct caccgccgca ctgccctacg gcgaaacccc ctgggtgcgg      2460
     tttaccgcgg ccgccaccga cgacgggtcg gccggtgtgc agttcggcat caccgatctg      2520
     gccatcaccc aatacgatgc gtccggtttc gcccatccgg ttcagctgcg acacaccgtg      2580
     ctggtgcccg ggccgccgcc gggttcggcg atcgcgggct gggacctggg atccgaactg      2640
     ctgggcagac cgggctgcgc cccgggaccc gacggcgtgc gctgcgccgc ctcgatggcc      2700
     ctggcacccg aggaaccggc caatctcagc cgcacactga ccgtaccccg cccggtgtcg      2760
     gtgaccccga tggtgtgggt gcgaccacgg cagggcccga agctggccga cttgatcgcc      2820
     gcgccttcca ccacccgggc cagcggtgat tccgaccttg tcgacatcct cggctcggcg      2880
     tacgcggccg ccgacggcga tccggccacc gcctggaccg cgccgcagcg ggtggtgcaa      2940
     cacaaaaccc cgccgacgct gacgctgacc ctgccgcggc ccaccgtggt gaccgggctg      3000
     cggctggccg ccagccggtc gatgttgccg gcccatccga cggtggtggc catcaacctg      3060
     ggcgacggcc cccaggtccg acaactgcag gtcggcgagc taacgacgct atggctgcat      3120
     ccccgggtga ccgacacggt gtcggtcagc ctgctggact gggacgatgt catcgatcgc      3180
     aacgcgctgg gcttcgacca gctcaagccg ccggggctgg ccgaagtggt ggtgcttggc      3240
     gccggcggcg ccccgattgc gccggccgac gccgcccgca accgcgcgcg tgcgctcacc      3300
     gtggattgcg atcacggccc ggtcgtcgcc gtcgcgggcc ggttcgtgca cacctcgatc      3360
     cgaaccacgg tgggcgcctt gctggacggt gaaccggtcg ccgcgctccc gtgtgaacgc      3420
     gagccgatag cgctgccggc gggacagcag gaattgctga tcagccccgg cgccgcgttc      3480
     gtggtcgacg gtgcccagtt gtcaactccc ggtgctggat tgtcaagcgc gacagttact      3540
     tctgctgaaa cgggtgcgtg gggtcccacc caccgcgaag ttcgggttcc cgagtcggcc      3600
     acttcccggg tgctggtggt acccgaaagc atcaactcgg gctgggtggc ccgcacgagc      3660
     accggggccc ggctgacacc gatcgccgtc aacgggtggc agcaggcctg ggtggtgccc      3720
     gccgggaacc ccggcaccat cacgctgaca ttcgcaccga actcgctgta tcgggcgagc      3780
     ctggcgatag ggctggccct gctgcccctg ctagctctgc tggcgttctg gcggaccggg      3840
     cgacggcagc tcgccgaccg gcccacacca ccctggaggc ccggagcctg ggcggcggcc      3900
     ggggtgctgg cggccggggc ggtgatcgcc agcatcgccg gggtcatggt gatgggcacg      3960
     gccctcggtg tgcggtatgc actgcgccgc cgggagcgac tacgtgaccg ggtcaccgtc      4020
     ggactggctg cgggcgggct gatcctggcc ggcgctgcgc tgtcccggca tccgtggcgg      4080
     tcggtcgacg gatacgccgg gaactgggcc agtgtgcaac tgctggcact gatttcggtt      4140
     tccgtggtgg cggcatcggt ggtcgccaca tcagagtctc gtggtcaaga ccgcatgcaa      4200
     tag                                                                    4203
//

If you have problems or comments...

PBIL Back to PBIL home page