(data stored in ACNUC7421 zone)

EMBL: CP001658.PE245

CP001658.PE245       Location/Qualifiers
FT   CDS_pept        complement(286839..287012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00238"
FT                   /product="conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23266"
FT                   /protein_id="ACT23266.1"
FT                   /translation="MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSS
FT                   SVLNRVEYGNRS"
     atgaaccgga tcgtcgcgcc cgccgccgca agcgtggtgg ttggtctgtt gctgggcgcg        60
     gccgcgatct tcggagtgac cctgatggtg cagcaggaca agaaaccgcc actccccggg       120
     ggcgatccgt cgtcatcagt gctcaaccgg gtcgagtacg gtaaccgtag ctag             174
//

If you have problems or comments...

PBIL Back to PBIL home page