(data stored in ACNUC7421 zone)

EMBL: CP001658.PE25

CP001658.PE25        Location/Qualifiers
FT   CDS_pept        29347..29709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23046"
FT                   /protein_id="ACT23046.1"
FT                   /translation="MSEQAGSSVAVIQERQALLARQHDAVAEADRELADVLASAHAAMR
FT                   ESVRRLDAIAAELDRAVPDQDQLAVDTPMGAREFQTFLVAKQREIVAVVAAAHELDRAK
FT                   SAVLKRLRAQYTEPAR"
     atgtcggagc aagccgggtc ttcggtagct gtcatccagg agcgccaggc tttgctggca        60
     aggcaacacg acgccgtggc cgaagccgac cgtgagttgg ccgacgtgct agccagcgcg       120
     catgcggcca tgcgggaaag cgtccgtcgg ctggatgcta tcgcggccga actcgaccgc       180
     gcggttccgg atcaggatca gcttgccgtc gatacgccca tgggagcgcg tgagtttcaa       240
     acgttcctgg tcgccaagca gcgcgagatc gtagcggtcg tcgccgccgc ccacgagctc       300
     gatcgcgcaa aaagcgctgt gctaaagcgc ctgcgggcac agtacacgga accggcccgt       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page