(data stored in ACNUC7421 zone)

EMBL: CP001658.PE250

CP001658.PE250       Location/Qualifiers
FT   CDS_pept        complement(289753..290595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23271"
FT                   /protein_id="ACT23271.1"
FT                   /translation="MTQPSGLKNLLRAAAGALPVVPRTDQLPNRTVTVEELPIDPANVA
FT                   AYAAVTGLRYGNQVPLTYPFALTFPSVMSLVTGFDFPFAAMGAIHTENHITQYRPIAVT
FT                   DAVGVRVRAENLREHRRGLLVDLVTNVSVGNDVAWHQVTTFLHQQRTSLSGEPKPPPQK
FT                   KPKLPPPAAVLRITPAKIRRYAAVGGDHNPIHTNPIAAKLFGFPTVIAHGMFTAAAVLA
FT                   NIEARFPDAVRYSVRFAKPVLLPATAGLYVAEGDGGWDLTLRNMAKGYPHLTATVRGL"
     gtgactcaac ccagcggcct gaagaacctg ctgcgcgcgg cggccggggc gctacccgtg        60
     gtgccccgga cagaccagct gcccaaccgg acggtgaccg tcgaggagct gccgatcgac       120
     cccgccaacg tcgcggccta cgcggcggtc accggtctgc gctacggcaa ccaggtgccg       180
     ttgacctatc cgttcgcgtt gacttttcca tcggtgatgt cgttggtgac cggcttcgac       240
     ttcccgttcg ccgcaatggg agcgatacac accgagaacc acatcacgca ataccggccg       300
     atcgcggtca ccgacgcggt gggcgtgcgg gtgcgcgcgg agaatctgcg cgaacaccgc       360
     aggggcctgc tggtcgatct ggtgaccaac gtcagcgtcg gcaacgatgt cgcctggcac       420
     caggtgacga cgttcctgca tcaacaacgc accagcttgt ccggcgaacc caaaccgccg       480
     ccgcaaaaaa agcccaagct acccccgccc gccgcggtcc tgcggatcac cccggcgaag       540
     atccgccgct atgccgccgt cggcggcgat cacaacccga tccacaccaa cccgatcgcg       600
     gcgaaactgt tcggcttccc caccgtcatc gcgcacggga tgttcactgc cgcggcggta       660
     ttggcgaata tcgaagcccg ttttccggac gcggtgcgct attcggttcg gttcgccaag       720
     ccggtgctgc tgccggccac cgcgggactc tacgtcgccg aaggcgatgg cggctgggat       780
     ctcacgctgc gcaatatggc caagggatac ccccacctga ccgctaccgt gcggggtcta       840
     tag                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page