(data stored in ACNUC7421 zone)

EMBL: CP001658.PE255

CP001658.PE255       Location/Qualifiers
FT   CDS_pept        296749..298059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00248"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23276"
FT                   /protein_id="ACT23276.1"
FT                   /translation="MAKTSHRVSSADGMSKRILRLIIAQSGFYSAALQLGNVSIVLPFV
FT                   VAELDAELWIAALIFPAFTAGGAIGNVVAPPAVAAVPRRHRLFIIVSCLAVLAGVNALC
FT                   ATIGKGSVAGILLVVNVTLIGVVSAISFVAFADLVAAMPSGTARARILLTEVGVGAALT
FT                   AVVAATLSFVPDQHPLSRNIHLLWTAAVAMAISAAICRALPHRIVPRVHAAPGLHKLVY
FT                   VGWTAIRTNGWYRRYLLVQVLFGSVVLGSSFHSIRVAAVPGDQPDEVVAVVLFVCVGLL
FT                   GGIALWNRVRERFGLVGLFVGSALVSIAAAVLSIAFDLAGAWPNVVAIGLVIALVSIAN
FT                   QSVFTAGQLWIARDAEPGLRTSLISFGQLVINAGLVGMGLALGLIAQDHDAVWPVMIVL
FT                   LLNLTAAYSATRFAPAKSVDVRGLPQVSRTSRPKTGG"
     gtggcaaaaa cgtcgcatcg ggtgagcagc gccgatggca tgagtaagcg tattttgcgt        60
     ttgataatcg cgcagagcgg cttctatagc gccgcacttc agctcgggaa tgtctcgatc       120
     gttctaccgt ttgtggtagc cgagctcgac gccgaattgt ggatagcggc tcttattttt       180
     cctgcattca cggccggtgg ggcgatcggg aatgtggtcg cgccgccggc ggtggccgcc       240
     gttccacgcc gtcaccgatt gttcattatt gtgtcctgtt tggccgtcct ggctggcgtc       300
     aatgccttgt gcgcaaccat cggcaaagga agcgtcgctg gaatcctatt ggtggtcaat       360
     gtgacgctga tcggggtcgt ttcggcgatc tccttcgtcg ccttcgcgga tctggtggcg       420
     gctatgccat caggaaccgc ccgagcccgc attcttctta ccgaggtcgg agtaggggcg       480
     gctttgacgg ccgtggtggc ggcgacgctg tcattcgtac ccgaccaaca cccattaagc       540
     aggaacattc acctactgtg gacggcagcc gtggcaatgg ctatctcggc ggccatatgc       600
     cgggcattgc ctcaccggat cgtccccagg gtccatgcgg cgcccggtct gcacaaactc       660
     gtgtacgtcg gttggacggc tatccgaacc aatggttggt atcgtcggta cctgcttgtg       720
     caggtactct ttggctcggt cgtgctcggg tcctcgttcc acagcattcg cgtcgccgcc       780
     gtacccgggg accagcccga cgaggtcgtt gccgtcgtcc ttttcgtctg cgtcggactc       840
     ttgggtggga tcgcgttgtg gaaccgcgtc cgggagagat ttggcctggt cggtttgttt       900
     gtcggcagtg cactcgttag catcgccgcg gcagtgctat ccatcgcatt cgatttggcc       960
     ggagcgtggc ccaacgtcgt cgccatcggt ctggtgattg cactggtatc catcgccaat      1020
     caaagcgtat tcaccgcagg ccaactgtgg attgcccgtg acgccgaacc cggcctgcga      1080
     acatccctca tctccttcgg ccagctcgtc atcaacgcag gcttagtcgg tatgggtttg      1140
     gcgctggggt tgattgccca ggatcacgat gcggtgtggc cggtgatgat cgttctgctg      1200
     ttgaacctga cggctgccta ctcagcgacg cggttcgctc cagccaagtc cgtggatgtt      1260
     cgtggcttgc ctcaggtttc gcgcacttcc cgacctaaaa ccgggggtta g               1311
//

If you have problems or comments...

PBIL Back to PBIL home page