(data stored in ACNUC7421 zone)

EMBL: CP001658.PE256

CP001658.PE256       Location/Qualifiers
FT   CDS_pept        complement(298056..298802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00249"
FT                   /product="succinate dehydrogenase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23277"
FT                   /protein_id="ACT23277.1"
FT                   /translation="MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTP
FT                   DLAVRWNCKAGKCGSCSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDV
FT                   SFNYQKAREIPSFAPPKELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEEN
FT                   KDAFAGPRFLMRIAELEMHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNA
FT                   LIPMKERVADRKYDPVVWLGSKLFRR"
     atgacgtaca gcgcgagtat gcgggtgtgg cgcggagacg aaagctgtgg cgaactccgc        60
     gaattcaccg tggaggtcaa cgagggcgag gtcgtgctgg acgtcatcct ccgtctacaa       120
     cagacgcaga caccggatct cgcagtgcgc tggaattgca aagctggcaa gtgcggatcc       180
     tgctcggccg agatcaacgg caaaccgcga ctgatgtgca tgacgcggat gtcgacattc       240
     gacgaggacg agatcgtcac ggtcacccca atgcggacgt ttccggtgat tcgcgatctt       300
     gttaccgacg tctcgttcaa ctaccaaaaa gcgcgcgaga tcccgtcttt cgcgccaccc       360
     aaggagctac agcccagcga gtaccgaatg gcgcaagtcg acgttgcacg ctcgcaggag       420
     ttccgcaagt gcattgaatg cttcctgtgc caaaacgtct gccacgtagt tcgcgatcac       480
     gaggaaaaca aggatgcgtt cgccggcccc cgcttcctga tgcgaatcgc cgaactcgaa       540
     atgcatccgc tggacacccg ggaccgacgc agccaagcac aggaagagca cggcctgggc       600
     tactgcaata tcaccaagtg ctgcaccgaa gtgtgcccag aaaacatcaa gatcaccgac       660
     aatgccctga tcccgatgaa agaacgggtc gccgaccgca agtatgatcc ggtggtatgg       720
     ctgggcagca agctgtttcg ccgctaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page