(data stored in ACNUC7421 zone)

EMBL: CP001658.PE26

CP001658.PE26        Location/Qualifiers
FT   CDS_pept        29824..31170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23047"
FT                   /protein_id="ACT23047.1"
FT                   /translation="MAFDAAMSTHEDLLATIRYVRDRTGDPNAWQTGLTPTEVTAVVTS
FT                   TTRSEQLDAILRKIRQRHSNLYYPAPPDREQGDAARAIADAEAALAHQNSATAQLDLQV
FT                   VSAILNAHLKTVEGGESLHELQQEIEAAVRIRSDLDTPAGARDFQRFLIGKLKDIREVV
FT                   ATASLDAASKSALMAAWTSLYDASKGDRGDADDRGPASVGSGGAPARGAGQQPELPTRA
FT                   EPDCLLDSLLLEDPGLLADDLQVPGGTSAAIPSASSAPSLPNLGGATMPGGGATPALVP
FT                   GVSAPGGLPLSGLLRGVGDEPELTDFDERGQEVRDPADYEHSNEPDERRADDREGADED
FT                   AGLGKSESPPQAPTTVTLPNGETVTAASPQLAAAIKAAASGTPIADAFQQQGIAIPLPG
FT                   TAVANPVDPARISAGDVGVFTATPLPLALAKLFWTARFNTSQPCEGQTF"
     gtggcgtttg acgcggcgat gtccacgcac gaagatctcc ttgccacgat caggtacgtc        60
     cgcgaccgaa ccggtgaccc aaacgcgtgg cagaccgggt tgacaccgac cgaggtgacc       120
     gcggtggtca cgtccacgac acgttccgaa cagctcgatg ccattttgcg taagatccgc       180
     cagcggcatt cgaacctgta ctatccagca ccgcccgatc gggaacaagg agacgccgcc       240
     cgtgccatcg cggatgcgga agcagctctg gcacatcaga attcggctac cgcgcagctc       300
     gatctgcagg tcgtctcggc aattctgaac gcgcatctga agactgtcga gggtggcgaa       360
     tcgctgcacg agcttcagca agagatcgaa gccgcggtac gcattcgatc cgatctggac       420
     actccggccg gcgcgcgtga tttccagcgt ttcttgatcg gcaagctcaa ggatatccgg       480
     gaggtggttg cgaccgcgag cctggacgct gcgtcgaaat ccgctctgat ggccgcctgg       540
     acatcgctgt atgacgcatc caagggcgac cgtggcgatg ccgatgaccg cggaccggcg       600
     tcggtcggct cgggcggcgc gcccgcacgc ggtgccggtc agcagccgga gttgccgaca       660
     cgagccgaac ccgattgcct cctcgactcg ctgctgctcg aggatccggg tttgctggcc       720
     gatgacctac aggtgccggg aggcacatcc gcggcaatac catcagcgtc gtcggcgcca       780
     agcctgccca atcttggcgg agcaacgatg ccgggtggcg gagcaacacc ggccttggtc       840
     cccggtgtga gcgcgccggg tgggcttccg ctctccggcc tgctgcgcgg cgtgggtgac       900
     gaaccggagt tgacggactt cgacgaacgg ggacaagaag tcagggatcc ggccgattat       960
     gagcattcca acgaaccgga tgagcgtcgc gccgacgacc gagaaggcgc cgacgaggac      1020
     gccgggctgg gcaagtcaga atcgccaccg caggctccga cgaccgtgac gctgcccaac      1080
     ggtgagacgg tgaccgcggc cagtccccag ctcgccgcgg cgatcaaggc ggcggccagc      1140
     ggcacaccga tcgcagatgc gttccaacaa cagggaattg ccatcccgct accgggaacc      1200
     gcggtcgcca accccgtcga ccccgcccgg atctcagcgg gagacgtagg tgtgttcacc      1260
     gccacgccct tgcccttggc cctagcaaag ctcttctgga cggccagatt caacacatct      1320
     cagccgtgcg agggccaaac tttctag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page