(data stored in ACNUC7421 zone)

EMBL: CP001658.PE261

CP001658.PE261       Location/Qualifiers
FT   CDS_pept        302806..305367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00254"
FT                   /product="nitrite reductase [NAD(P)H] large subunit nirB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23282"
FT                   /protein_id="ACT23282.1"
FT                   /translation="MPTAGSSRAPAAAREIVVVGHGMVGHRLVEAVRARDADGSLRITV
FT                   LAEEGDAAYDRVGLTSYTESWDRALLALPGNDYAGDQRVRLLLNTRVTQIDRATKSVVT
FT                   AAGQRHRYDTLVLATGSYAFVPPVPGHDLPACHVYRTFDDLDAIRAGAQRTLDGGHTDG
FT                   GVVIGGGLLGLEAANALRQFGLQTHVVEMMPRLMAQQIDEAGGALLARMIADLGIAVHV
FT                   GTGTESIESVKHSDGSVWARVRLSDGEVIDAGVVIFAAGIRPRDELARAAGLAIGDRGG
FT                   VLTDLSCRTSDPDIYAVGEVAAIDGRCYGLVGPGYTSAEVVADRLLDGSAEFPEADLST
FT                   KLKLLGVDVASFGDAMGATENCLEVVINDAVKRTYAKLVLSDDATTLLGGVLVGDASSY
FT                   GVLRPMVGAELPGDPLALIAPAGSGAGAGALGVGALPDSAQICSCNNVTKGELKCAIAD
FT                   GCGDVPALKSCTAAGTSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFEIITATE
FT                   VRTFSGLLDRFGRGKGCDICKPVVASILASTGSDHILDGEQASLQDSNDHFLANIQKNG
FT                   SYSVVPRVPGGDIKPEHLILIGQIAQDFGLYTKITGGQRIDLFGARVDQLPLIWQRLVD
FT                   GGMESGHAYGKAVRTVKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGC
FT                   ARECAEARGKDVGVIATEKGWNLYVAGNGGMTPKHAQLLASDLDKETLIRYIDRFLIYY
FT                   IRTADRLQRTAPWVESLGLDHVREVVCEDSLGLAEEFEAAMQRHVANYKCEWKGVLEDP
FT                   DKLSRFVSFVNAPDAVDSTVTFTERAGRKVPVSIGIPRVRS"
     atgcctacgg ctgggagttc gcgcgcgcct gccgcggctc gcgagatcgt cgtggtcggc        60
     cacggcatgg tgggccatcg gctggtcgaa gcggtgcgtg cccgtgacgc ggacgggtcg       120
     ctgcggatca cggtgctggc cgaggagggc gatgcggcct atgaccgggt cggcctgacg       180
     tcctataccg aaagctggga ccgcgccctg ttggccttgc cgggtaacga ttacgccggt       240
     gaccagcggg ttcggttgct actaaacacc cgagtcaccc agattgaccg ggcaaccaag       300
     tcggtggtca ccgcggcagg gcaacggcat cgctacgaca ccctggtgct ggccaccggc       360
     tcctacgcat tcgtcccgcc ggtgcccggc cacgacctgc ccgcgtgcca cgtctaccgc       420
     acctttgacg atctcgacgc tatccgcgcc ggcgcccagc gcaccctgga cggcggtcac       480
     accgatggcg gggtggttat cggtggcggc ctgctgggcc tggaagccgc caatgcgctg       540
     cgccagttcg ggttgcagac acacgtcgtc gagatgatgc cacgattgat ggcccaacag       600
     atcgacgagg ccgggggtgc actactggcc aggatgatcg ccgatctcgg gatcgcggtg       660
     cacgtcggga ccggtaccga gtcgatcgag tcggtgaagc attcggatgg ctcggtgtgg       720
     gcgcgggttc gcctgagcga cggcgaggtg atcgatgctg gggtggtgat ctttgccgcc       780
     ggcatccggc cgcgcgacga gttggccagg gcggcggggc tggcgatcgg cgaccggggc       840
     ggtgtgctca ccgacttgtc ctgccggaca agcgatcccg atatctacgc ggtcggcgaa       900
     gtcgccgcga tagacgggcg gtgttacggc ctggtcgggc ccggatacac cagcgccgag       960
     gtggtggccg accgactgct ggacgggtcg gccgagttcc ccgaagcgga cctgtcgacc      1020
     aaactcaagc tgttgggtgt cgacgtcgcc agcttcggcg acgcgatggg ggcaaccgag      1080
     aactgcctcg aggttgtcat caatgacgcg gtgaagcgca catatgccaa gttggtgctc      1140
     tccgacgacg ccaccacgct gctcggtggc gtgctggtgg gcgatgcctc gtcgtacggg      1200
     gtgctgcggc cgatggtcgg cgccgaactg cccggggatc ccctggcgct gatcgcgccg      1260
     gccggatctg gggccggcgc tggcgcttta ggtgttgggg cgctgccgga ttcggcccag      1320
     atctgctcgt gcaacaacgt caccaagggc gagctgaagt gcgcgattgc cgacggttgt      1380
     ggggacgttc ccgcgctgaa gtcatgcacc gcggccggca cgtcgtgtgg gtcgtgcgtg      1440
     ccgctgctca agcagctgct agaagccgag ggtgtggagc agtccaaggc gctgtgcgag      1500
     cacttcagcc agtcgcgcgc ggagcttttt gaaatcatca ccgccaccga agtccggact      1560
     ttctccgggt tgcttgaccg ctttggacgc ggaaagggtt gcgacatctg caaacccgtg      1620
     gtcgcctcta tcctggcatc caccggctcc gaccacattt tggacggcga gcaggcctcg      1680
     ctacaagatt ccaacgacca cttcctggcc aacatccaga agaacggcag ttactcggtg      1740
     gtgccgaggg tgcctggcgg tgacatcaag ccagaacacc tgattttgat cggccagatc      1800
     gcacaggact tcggcctcta caccaagatc accggcggtc agcggatcga cttgttcggc      1860
     gcccgggtgg atcagctgcc cttgatctgg cagcgactgg ttgatggcgg catggaatct      1920
     gggcacgcct acggcaaggc ggtgcggacc gtgaagagct gcgtgggcag cgactggtgc      1980
     cgctacggtc agcaggattc ggtgcagctg gccatcgacc tggaactgcg ttatcgcggg      2040
     ctacgggcac cgcacaaaat aaagctgggc gtctcgggtt gcgcgcggga atgcgccgag      2100
     gcgcgcggca aggatgtggg cgtgatcgcc accgagaaag gctggaacct ttacgtcgcc      2160
     ggcaacggcg gcatgacgcc caagcacgct caactactgg ccagcgacct cgacaaagag      2220
     acgctcatcc gctacatcga ccgctttctc atttactaca tccgcacggc cgaccggctg      2280
     cagcgaaccg cgccatgggt ggaatcgctt gggctggacc atgtgcgcga ggtggtctgc      2340
     gaggactcgc tgggtctggc cgaggaattc gaggccgcga tgcaacgcca tgtcgccaac      2400
     tacaagtgcg agtggaaggg cgtgctggag gacccggaca agctgtcccg gttcgtttcc      2460
     ttcgtcaacg cccccgatgc cgtcgactcg acggtgacct tcaccgagcg tgccgggcgc      2520
     aaagtacctg tgtccattgg tatcccgcgg gtccgatcat ga                         2562
//

If you have problems or comments...

PBIL Back to PBIL home page