(data stored in ACNUC7421 zone)

EMBL: CP001658.PE262

CP001658.PE262       Location/Qualifiers
FT   CDS_pept        305393..305749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00255"
FT                   /product="nitrite reductase [NAD(P)H] small subunit nirD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23283"
FT                   /protein_id="ACT23283.1"
FT                   /translation="MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSV
FT                   HAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPAR
FT                   VTPEGRIQVARVAV"
     gtgacgcttc tcaacgacat tcaggtatgg accaccgcct gcgcatacga ccatctcatt        60
     ccgggacgtg gtgtcggggt gttactcgat gacggtagtc aggtggcact gttccggctc       120
     gacgacggct cggtgcacgc ggtcggtaac gtcgacccgt tctccggtgc tgcggtgatg       180
     tcccgcggca tcgtcggtga tcgcggaggt cgcgccatgg tgcaatcgcc gatcctgaag       240
     caggctttcg cgctcgacga tggctcgtgc ctcgacgatc cgcgcgtttc ggtgccggtg       300
     tatccggcgc gcgtcacacc cgaaggccgc attcaggtcg cgcgggtagc ggtctag          357
//

If you have problems or comments...

PBIL Back to PBIL home page