(data stored in ACNUC7421 zone)

EMBL: CP001658.PE263

CP001658.PE263       Location/Qualifiers
FT   CDS_pept        complement(305765..306289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00256"
FT                   /product="bifunctional cobalamin biosynthesis protein cobU"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23284"
FT                   /protein_id="ACT23284.1"
FT                   /translation="MRILVTGGVRSGKSTHAEALLGDAADVVYVAPGRPAAGSDPDWDA
FT                   RVALHRARRPPTWLTVETADVATALSEARSPVLVDCLGTWLTAIMDGEALWSAATADVY
FT                   AVLEARLDGLCAALTGLPTAIVVTNEVGLGVVPSHSSGVLFRDLLGTINRRVAAVCDEV
FT                   HLVIAGRVLKL"
     gtgcggatac tggtcactgg cggcgtccgc tcgggaaagt ccacgcacgc cgaagcgttg        60
     ttgggcgatg cggccgacgt cgtctacgtc gcgcctggcc gcccggccgc tggcagcgat       120
     cccgattggg acgcccgggt cgcactgcat cgcgctcgcc gcccaccgac ctggctaacg       180
     gtggaaacgg ccgacgtcgc gacggctttg tccgaggcac gaagtcccgt gctcgtggac       240
     tgcttgggca cctggctgac ggccatcatg gatggcgagg cgttgtggtc tgctgcgacc       300
     gcggacgtct acgccgtcct cgaggcacgg ctcgacgggt tgtgcgccgc gctgaccgga       360
     ttgcccactg cgatcgtggt gacgaacgag gtcggcctcg gggtggtgcc atcccattct       420
     tcgggcgtgc tgtttcgcga tctactgggc acaatcaacc gacgcgtggc agccgtctgc       480
     gatgaggtac atctggtcat cgccggacgt gtgctcaagc tgtga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page