(data stored in ACNUC7421 zone)

EMBL: CP001658.PE265

CP001658.PE265       Location/Qualifiers
FT   CDS_pept        complement(307817..309487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00258"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23286"
FT                   /protein_id="ACT23286.1"
FT                   /translation="MTAPIWMASPPEVHSALLSSGPGPGPLLVSAEGWHSLSIAYAETA
FT                   DELAALLAAVQAGTWDGPTAAVYVAAHTPYLAWLVQASANSAAMATRQETAATAYGTAL
FT                   AAMPTLAELGANHALHGVLMATNFFGINTIPIALNESDYARMWIQAATTMASYQAVSTA
FT                   AVAAAPQTTPAPQIVKANAPTAASDEPNQVQEWLQWLQKIGYTDFYNNVIQPFINWLTN
FT                   LPFLQAMFSGFDPWLPSLGNPLTFLSPANIAFALGYPMDIGSYVAFLSQTFAFIGADLA
FT                   AAFASGNPATIAFTLMFTTVEAIGTIITDTIALVKTLLEQTLALLPAALPLLAAPLAPL
FT                   TLAPASAAGGFAGLSGLAGLVGIPPSAPPVIPPVAAIAPSIPTPTPTPAPAPAPTAVTA
FT                   PTPPPGPPPPPVTAPPPVTGAGIQSFGYLVGDLNSAAQARKAVGTGVRKKTPEPDSAEA
FT                   PAAAAAPEEQVQPQRRRRPKIKQLGRGYEYLDLDPETGHDPTGSPQGAGTLGFAGTTHK
FT                   ASPGQVAGLITLPNDAFGGSPRTPMMPGTWDTDSATRVE"
     atgaccgccc cgatctggat ggcttcgccc ccagaggtgc actcggcgct gctaagcagc        60
     gggcctgggc ccggtccgct gctggtgtcg gccgaggggt ggcactcgtt gagcatcgcc       120
     tacgcggaga cggccgacga gctggccgcg ctgttggccg ccgtacaggc cggcacctgg       180
     gacggcccga ccgccgcggt ttacgtggcc gcccataccc cttatctggc gtggctggtg       240
     caggccagcg ctaacagcgc ggccatggcc acccggcaag aaaccgcggc caccgcctac       300
     ggcaccgcct tggccgcgat gccaacgttg gccgagctgg gcgccaacca cgccctccac       360
     ggcgtgctga tggcgacgaa cttcttcggc atcaacacca tcccgatcgc gctcaacgag       420
     tccgactacg cgcggatgtg gatccaggcc gccaccacga tggccagcta tcaagcggtc       480
     tcgaccgcgg cggtggccgc cgcaccgcag accaccccag ccccccagat cgtgaaagcc       540
     aacgcgccga cagcggcttc cgacgagccg aaccaagtcc aggaatggct gcaatggttg       600
     cagaagatcg ggtataccga cttctacaac aacgttatac aaccgttcat caactggctg       660
     accaacctcc cctttttgca agcgatgttt tccggatttg atccgtggct gccctcgctg       720
     ggtaatccgc taaccttcct aagcccggcc aacattgcgt tcgcccttgg ctaccccatg       780
     gacatcggat cttatgtcgc cttcctgtcg caaaccttcg cattcatcgg ggcggatctg       840
     gcggcggcgt tcgcgtcggg caatcccgca actatcgctt ttaccctgat gttcaccacg       900
     gtcgaagcca ttggcacgat catcaccgat accatcgcgc tggttaaaac gctgctcgag       960
     caaactcttg cgttgctccc ggcggcgctg cccctgctag ccgccccgct ggcgccgttg      1020
     acccttgccc ctgcgagtgc agcaggcggc ttcgcgggct tgtctgggct ggcgggcctg      1080
     gttggcatcc cgccatccgc gccgcccgtc atcccgccgg tcgcggcgat tgccccgagt      1140
     atcccgaccc ccaccccaac tccagcccca gccccggccc ccacggccgt gaccgcgccg      1200
     acgcccccgc ccgggccgcc accgccgccg gtgaccgccc cgccgccggt gaccggagcc      1260
     ggcatacaaa gcttcgggta cctggtgggt gacctgaact cggcggcgca ggccaggaag      1320
     gccgtcggca ccggcgttcg aaagaagacg ccggaacccg acagcgccga ggccccagcg      1380
     gccgcggcgg cgcccgagga acaggttcaa ccgcagcggc gtcggcggcc aaagatcaaa      1440
     cagctcggcc gcggttacga atacctggat ttagaccccg aaaccggcca cgacccgacg      1500
     ggttcgcctc aaggagcggg aaccctgggt ttcgccggaa caacccacaa ggccagtccc      1560
     ggacaagtcg caggactgat cacgttaccc aacgacgcgt tcggcggcag cccacgcacg      1620
     ccaatgatgc ccggaacctg ggacaccgac tcagcgaccc gggtggagtg a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page