(data stored in ACNUC7421 zone)

EMBL: CP001658.PE268

CP001658.PE268       Location/Qualifiers
FT   CDS_pept        complement(310234..310689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23289"
FT                   /protein_id="ACT23289.1"
FT                   /translation="MARSQEPSRGLLDPVAKMLRLPFGTPDFIEKIVTGSVNQVGRRTL
FT                   YVLITTWDAAGGGPFAASAIATTGLAKTAEIVQSMFIGPVFNPLLKMLGADKIAIRASL
FT                   CAAQLVGLGIMRYGVRSEPLHSMSVEMLVDAIGPTMQRYLVGDIGRG"
     atggcccgta gccaagagcc atcacgcgga ctcctcgacc cggtagcgaa gatgctgcgg        60
     ttgcccttcg gcacaccgga tttcatcgaa aaaatcgtca ccggaagcgt caaccaggta       120
     ggccgccgaa ccctctacgt gctgatcacc acctgggatg cggccggcgg cggtcccttt       180
     gcggcgagcg ccatcgcaac caccgggcta gccaagaccg ccgagatcgt gcagtccatg       240
     ttcatcggac cggtcttcaa cccgttgctc aagatgctcg gggccgacaa gattgccatc       300
     cgagcgtcgc tgtgcgccgc tcaactcgtc ggtttgggca tcatgcgcta cggggtgcgt       360
     tctgagccgc tgcactccat gtcggtggag atgctggtcg acgccattgg cccgacaatg       420
     cagcgctacc tggtcggcga tatcggtcgc ggatag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page