(data stored in ACNUC7421 zone)

EMBL: CP001658.PE27

CP001658.PE27        Location/Qualifiers
FT   CDS_pept        31291..31608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23048"
FT                   /protein_id="ACT23048.1"
FT                   /translation="MTDRIHVQPAHLRQAAAHHQQTADYLRTVPSSHDAIRESLDSLGP
FT                   IFSELRDTGRELLELRKQCYQQQADNHADIAQNLRTSAAMWEQHERAASRSLGNIIDGS
FT                   R"
     atgacagatc gaattcacgt gcagcctgca catttacgtc aggccgctgc ccatcaccag        60
     cagaccgccg actacctgcg gaccgtgccg tcgtcgcacg acgcgatccg cgaaagtctg       120
     gactcgctgg ggcctatttt cagtgagctc cgcgacaccg ggcgtgagct gctcgagctc       180
     agaaagcagt gctaccagca gcaagccgac aaccacgccg atattgccca gaacctgcga       240
     acgtcggccg cgatgtggga gcagcacgag cgagcggcgt cgcgcagcct cggcaacatc       300
     attgacggga gccgatga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page