(data stored in ACNUC7421 zone)

EMBL: CP001658.PE271

CP001658.PE271       Location/Qualifiers
FT   CDS_pept        complement(312699..314108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00263"
FT                   /product="membrane nitrite extrusion protein narK3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23292"
FT                   /protein_id="ACT23292.1"
FT                   /translation="MGRSHQISDWDPEDSVAWEAGNKFIARRNLIWSVAAEHVGFSVWS
FT                   LWSVMVLFMPTSVYGFSAGDKFLLGATATLVGACLRFPYTFATAKFGGRNWTIFSALVL
FT                   LIPTVGSILLLANPGLPLWPYLVCGALAGLGGGNFAASMTNINAFFPQRLKGAALALNA
FT                   GGGNLGVPMVQLVGLLVIATAGDREPYWVCAIYLVLLAVAGLGAALYMDNLTEYRIELN
FT                   TMRAVVSEPHTWVISLLYIGTFGSFIGFSFAFGQVLQINFIASGQSTAQASLHAAQIAF
FT                   LGPLLGSLSRIYGGKLADRIGGGRVTLAAFCAMLLATGILISASTFGDHLAGPMPTATM
FT                   VGYVIGFTALFILSGIGNGSVYKMIPSIFEARSHSLQISEAERRQWSRSMSGALIGLAG
FT                   AVGALGGVGVNLALRESYLTSGTATSAFWAFGVFYLVASVLTWAIYVRRGLKSAGELVP
FT                   ATTAPAGLAYV"
     atgggccgtt cccaccagat ctccgactgg gatcccgaag actcggtggc gtgggaggcc        60
     ggcaacaaat tcatcgcccg acgcaatctg atctggtcgg tggccgccga gcacgtcgga       120
     ttttccgtct ggtccctctg gtcggtgatg gtgctgttca tgcccacatc ggtgtacggc       180
     ttttccgccg gcgacaagtt cctgctcggc gccaccgcga ccttggtcgg ggcatgcctg       240
     cgcttccctt acacatttgc caccgcaaag ttcggggggc gcaactggac catcttttcc       300
     gcactggtgc tgttgattcc gaccgttggc agcattctgt tgctggccaa ccctggtttg       360
     ccactgtggc cgtatctggt gtgcggtgcg ctagccggcc tcggcggcgg caacttcgcc       420
     gcctccatga cgaacatcaa cgctttcttt ccgcaacgac tcaagggcgc cgcgcttgcg       480
     ctcaacgcgg gtggcggcaa cctcggggtg ccgatggtgc agttggtcgg cctgctggtg       540
     atcgcaacgg ccggtgaccg cgagccctac tgggtgtgcg cgatatatct ggtgctgctg       600
     gcggtcgccg gcctcggcgc cgcactgtac atggacaacc tgacggagta tcgcatcgag       660
     ctgaacacca tgcgtgcggt agtgtccgag ccgcacacct gggtgatctc gctgctgtac       720
     atcggcactt tcggctcgtt catcgggttc tctttcgcat tcggtcaggt gctgcagatc       780
     aacttcatcg ccagcggtca gagcacggcg caggcctcgc tgcatgcggc ccagatcgcc       840
     ttcctggggc cgctattggg atcgctgtcc cgaatatatg gcggcaagct cgccgaccgt       900
     atcggtggcg gccgagtcac cctagctgcc ttctgcgcca tgctgctggc caccggaata       960
     ctcatcagcg caagcacttt cggtgaccac ctggccgggc cgatgccgac tgcgacgatg      1020
     gtcggctacg tcatcggctt cacggctctg ttcattttgt ccggcatcgg caatggctct      1080
     gtgtacaaga tgattccgtc gatcttcgag gcgcgcagcc attcgctgca gatcagtgaa      1140
     gccgagcgca ggcagtggtc gcggtcgatg tcaggcgcgc tgatcggcct ggccggggcg      1200
     gtcggcgcgc tcggcggagt gggcgtcaac ctggctctgc gagagtccta cctgaccagt      1260
     ggcacggcca cctcggcatt ttgggccttc ggggtgttct acctggtcgc ctcggtgctg      1320
     acctgggcga tttatgtgcg tcggggccta aagagcgccg gcgagctcgt gccggcgacc      1380
     accgcacccg cgggcttggc ctacgtctag                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page