(data stored in ACNUC7421 zone)

EMBL: CP001658.PE273

CP001658.PE273       Location/Qualifiers
FT   CDS_pept        complement(314804..315706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23294"
FT                   /protein_id="ACT23294.1"
FT                   /translation="MTTLEILRSGPLALVEDLGRAGLAHLGVGRSGAADRRSHTLANRL
FT                   VANPDDWATVEVTFGGFSARVRGGDVDIAVTGADTDPTVNGIMVGTNSIHHVRDGQVIS
FT                   LGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGPSPLRAGDVLPVGEHTDDYPELD
FT                   QAPVAAIEEHLVELRVVPGPRDDWLVDPDALVHTIWMASNRSDRVGMRLQGRPLQHRWP
FT                   DRQLPGEGVTRGAIQVPPNGLPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVR
FT                   LHWARPRSRLPGQGVTQAW"
     atgacaacac tggaaatcct gcgcagcgga ccgctggccc tcgtcgaaga cctcggccgt        60
     gccggactgg cccatctcgg tgtcggtcga tccggtgccg ccgaccgccg ctcccacacg       120
     ctggccaacc ggctagtcgc caaccccgac gattgggcca cggtcgaagt gaccttcggc       180
     ggcttctcgg cgcgggttcg cggcggcgac gtcgacatcg cggtgacggg cgccgacacc       240
     gatccgaccg tgaacggaat catggtcggc accaacagca ttcaccacgt ccgggacggc       300
     caggtgatct cactgggcac cccacgggcc gggctgcgga cctatctggc ggtgcgcggc       360
     ggcgtctgtg tggagcccgt gctggggtca cgcagctacg acgtgatgtc ggcgatcggc       420
     ccgtcgccgc tacgggccgg agacgtgctg ccggtcggcg aacacaccga cgactatccc       480
     gaactcgacc aggcaccggt ggccgctatc gaggagcatc tggtggagct gcgggtggtg       540
     cccgggccgc gcgacgactg gctggtggac ccggacgcgt tggtgcatac catctggatg       600
     gcgtccaacc gcagtgaccg cgtaggaatg cggctacagg gccgcccgct acagcaccgc       660
     tggccggatc ggcaactgcc cggcgaaggc gttacccgcg gcgcaatcca ggtgccgccc       720
     aacggattac cggtgatcct ggggccggat cacccgatca ccggaagcta tccggtcgtc       780
     ggcgtcatca ccgacgagga catcgacaag gtcgcgcaga tacggcccgg ccaatatgtg       840
     cgactgcact gggcacgacc ccggtctcgg ttgcctggcc agggtgtaac acaagcctgg       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page