(data stored in ACNUC7421 zone)

EMBL: CP001658.PE274

CP001658.PE274       Location/Qualifiers
FT   CDS_pept        complement(315723..316376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23295"
FT                   /protein_id="ACT23295.1"
FT                   /translation="MSVMDVFMDAALACTVLDYGDHALMLQCDSTADAMAWTDALRAAA
FT                   LPGVVDIVAASRTVLVKLDAPRYQGVTRQRLRRLRVTPEAVAAADHRCDLVIDVVYDAP
FT                   DLAEVARCTGLTTAAVINAHTATGWRAGFSGSAPGFAYLIDGDPSLRVPRRPERRTSMP
FT                   PGSVALADGFSAIYPSQAPSDWQIIGHTDAVLWDVDRPQPALLTPGMWVQFRAA"
     atgagtgtga tggacgtctt tatggacgcg gcattggcct gcaccgtgct cgactacggc        60
     gaccatgcgc tgatgctgca atgtgacagc accgctgacg caatggcatg gaccgatgca       120
     ttgcgagccg cggcgctacc cggtgtggtc gacatcgttg cggcctcgcg caccgtattg       180
     gtgaagctgg acgcgccccg ctaccaaggg gtcacccgtc agcggctgcg caggttgcgg       240
     gtcacccccg aggcggtggc tgcggccgat caccgatgcg acctggtaat cgacgtcgtc       300
     tacgacgccc cagacctcgc cgaggtcgcc cgctgcaccg gcctgaccac cgcagcggtc       360
     atcaacgccc acaccgccac cggatggcgg gcgggattca gtgggtccgc cccggggttc       420
     gcctacctga tcgacggcga cccgagcctg cgggtgccgc gccggcccga acggcgcacc       480
     tcgatgccgc ccggatcggt cgccctcgcc gacggattca gcgcgatata tccatctcaa       540
     gcgcccagcg attggcagat catcggccac accgacgcgg tcctgtggga tgtcgaccga       600
     ccccagccgg cgctgctcac accgggcatg tgggttcagt tccgggccgc ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page