(data stored in ACNUC7421 zone)

EMBL: CP001658.PE277

CP001658.PE277       Location/Qualifiers
FT   CDS_pept        321271..322662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00269"
FT                   /product="membrane nitrite extrusion protein narU"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23298"
FT                   /protein_id="ACT23298.1"
FT                   /translation="MALTTAPAIDYALPRQQDEGDHWIDDWRPEDPVFWETIGRPIARR
FT                   NLIFSIFAEHVGFSVWMLWSIVVVQMTAAAPGHPAASGWALSASQALCLVAVPSGVGAF
FT                   LRLPYTFAIPIFGGRNWTTVSAALLVIPCLLLAWAVSHPSLPFAVLVVIAATAGFGGGN
FT                   FASSMANISFFYPEKDKGWALGLNAAGGNIGVAVVQKIIPPIVVAGSGVALSRAGLFFV
FT                   PLAVAAAVCAFLFMNNLTEAKADVKPVWQSLRHADTWIMSLLYIGTFGSFIGYSAAFPT
FT                   LLKTVFGRGDIALGWAFLGAGIGSLVRPLGGKLADRIGGARITAASFVMLAAGAAAALW
FT                   SVQSVNLPVFFVSFMFLFVATGIGNGSSYRMISRIFQVKGEVAGGDPETMVNMRRQAAG
FT                   ALGIISSIGAFGGFVVPLAYAWSKVHFGNIEPALHFYVAFFLALLVVTWYCYLRRTTPM
FT                   GQVGV"
     atggcactca ccaccgcccc ggcaatcgat tatgcgctgc cacgccagca ggatgagggc        60
     gatcactgga tcgacgactg gcgcccggaa gacccggtgt tctgggagac gatcggcagg       120
     ccgatcgccc gccgtaacct gatcttctcc atcttcgccg agcacgtcgg cttcagcgtg       180
     tggatgctgt ggagcatcgt ggttgtccag atgaccgccg ccgctcccgg gcaccccgcc       240
     gcgtccggct gggcgctgtc cgccagccag gccctatgtt tggtcgccgt ccccagcggt       300
     gtcggggcgt tcctccggct gccgtacacc ttcgcgatcc cgatctttgg tggccgcaac       360
     tggacgaccg tctcggcggc gctgctggtg atcccgtgcc tgctgctggc ttgggcggtg       420
     agccaccctt ccctgccgtt cgcggtgttg gtggtgatcg cggccaccgc cggtttcggt       480
     ggcggcaact ttgcctcatc gatggccaac atctcgttct tctacccgga gaaggacaag       540
     ggttgggcgc tgggcctgaa cgcggccgga ggcaacatcg gggtggcggt ggtgcagaag       600
     atcattccgc ccatcgtggt cgccggcagt ggggtggcac tgtcgcgtgc cggactgttc       660
     ttcgtgccct tggccgtcgc cgccgcggtg tgcgcattcc tgtttatgaa caacctcacg       720
     gaggccaagg ccgatgtgaa gccggtgtgg cagtcgctgc ggcatgccga cacctggatc       780
     atgtcgctgc tgtacatcgg cacctttggg tcgttcatcg ggtattcggc ggccttcccg       840
     acgttgctca agaccgtgtt tggccgtggt gacatcgcgt tgggttgggc cttcctcggc       900
     gcgggcatcg gttccctggt ccgtccgctg ggcggcaagc tcgccgaccg gatcggcggt       960
     gcgcggatca ccgcggccag tttcgtcatg ctggcggccg gggcggctgc ggcgttgtgg      1020
     tcggtgcagt cggtcaatct gccggtgttc ttcgtcagct tcatgttctt gttcgttgcc      1080
     accggcatcg gcaatggttc gagctaccgg atgatctcga ggatcttcca ggtcaaaggc      1140
     gaagtcgccg gcggggatcc ggaaacgatg gtgaacatgc gccgacaggc cgccggagcg      1200
     ctgggcatca tctcctcgat cggcgcgttc ggcgggtttg tggtgccgct ggcctacgcc      1260
     tggtcgaagg tgcacttcgg caatatcgaa cccgccctgc acttctacgt ggcgttcttc      1320
     cttgccctgc tcgtcgtcac ctggtactgc tacctgcgta gaaccacccc catgggccag      1380
     gtgggggtgt ag                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page