(data stored in ACNUC7421 zone)

EMBL: CP001658.PE278

CP001658.PE278       Location/Qualifiers
FT   CDS_pept        complement(322704..323213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23299"
FT                   /protein_id="ACT23299.1"
FT                   /translation="MGTRSKSRTRQLKQSNGCTATTSGASDRRRRARRRTAPAWLREDE
FT                   WLRHHLPHPPRQLSRCLHRRRRSACHHRYSRRTPKGGLPMTSSLVPISEARAHLSRLVR
FT                   ESADDDVVLMNHGRPAAILISAERYESLMEELEDLRDRLSVHEREHVTMPLDKLGAELG
FT                   VDIGRV"
     gtgggtacgc ggtcgaaatc gagaactcgg cagctaaagc aatccaacgg ctgcaccgcc        60
     acgaccagcg gcgcatctga ccgccgtcgc cgcgctcgcc gacgaaccgc gcccgcgtgg       120
     ctgcgagaag atgagtggct tcgacaccac ttaccgcatc cgcctcggca actatcgcgt       180
     tgtttacatc gtcgacgacg cagcgcgtgt catcaccgtt actcgcgtcg gacaccgaag       240
     gggggtctac cgatgaccag cagtctagtg cctattagtg aagcccgcgc tcacctatcg       300
     aggcttgtgc gtgaatccgc cgacgatgac gtcgtgttga tgaatcatgg ccgacccgca       360
     gccatcctca tctcagctga gcgctacgag agcctaatgg aagagcttga agacctgcgc       420
     gaccggctca gcgtgcacga gcgagagcac gtcaccatgc cgctggacaa gctcggtgcc       480
     gagctgggcg ttgacatcgg cagagtctga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page