(data stored in ACNUC7421 zone)

EMBL: CP001658.PE279

CP001658.PE279       Location/Qualifiers
FT   CDS_pept        complement(323278..324471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23300"
FT                   /protein_id="ACT23300.1"
FT                   /translation="MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYY
FT                   LAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEA
FT                   VIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVRE
FT                   VLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWK
FT                   EEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRL
FT                   ADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWR
FT                   DRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR"
     atgagccgca tggccgcccc ggtgtcgctg gacgtgcacg gacgccaggt catcgtcacg        60
     catccgggca gggtcgtctt ccccgctcac aacgatcgaa agggctacac caagttcgat       120
     ctggtccgct attacctcgc cgtggccgag ggggcgatgc gcggggtggc cggccggccg       180
     atgattctca agcgtttcgt caagggcatc tccgccgagg cggtgtttca gaagcgcgca       240
     ccggcaaacc ggccagactg ggtggacgtg gccgagctgc actatgcgtc gggccgctcc       300
     gccgcggagg cggtcattca cgacgccgcc gggctggcgt gggtgatcaa cctggggtgt       360
     gtggatctca atccgcatcc ggtgctcgcc ggcgacctcg atcatcccga cgagctgcgg       420
     gtggacttgg acccgatgcc cggggtcgcg tggcagcggg tcgtcgaggt cgcgttggtg       480
     gtccgggagg tgctggagga ttacgggttg accgcatggc cgaagacgtc cgggtcgcgg       540
     ggctttcacg tctatgcccg gatcgcgcct tgctggtcgt ttccccaggt gcgcctggcc       600
     gcccagaccg ttgcgcgtga ggtcgaacgg cgcctacccg acgcggcaac cagtcgttgg       660
     tggaaggaag aacgcgaggg cgtgttcgtc gacttcaacc agaacgccaa ggaccgcacg       720
     gtcgcgtcgg cctactcggt gcgggccacc ccggatgccc gggtgtccac gccgctgcac       780
     tgggaggagg tgcccggctg cgacccggcg gtgttcacca tggccaccgt gcccagccgg       840
     ttggccgaca tcggtgaccc ctgggccggg atggatgacg cggttggccg gctcgaccgg       900
     ctgttgatgc tggccgagga actgggtccg ccgcagaagg cgcaatccgc caagccgctg       960
     atcgagatcg cccgcgccaa gacgcgggcc gaggcgatgg cggcgttgga catctggcgc      1020
     gaccggtatc ccggcgccgc ggctttgctg cggcccgccg atgtgctggt cgacggcatg      1080
     cgcgggccga gttcgatctg gtatcggatc cggatcaacc tgcagcacgt cccggccgac      1140
     cagcgcccgc cgcaggagga gctgatcgcc gactacagcc cgtggccgcg gtga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page