(data stored in ACNUC7421 zone)

EMBL: CP001658.PE28

CP001658.PE28        Location/Qualifiers
FT   CDS_pept        31616..31921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23049"
FT                   /protein_id="ACT23049.1"
FT                   /translation="MTDANPAFDTVHPSGHILVRSCRGGYMHSVSLSEAAMETDAETLA
FT                   EAILLTADVSCLKALLEVRNEIVAAGHTPSAQVPTTDDLNVAIEKLLAHQLRRRNR"
     atgaccgacg ccaatcccgc tttcgacacg gtccacccca gcgggcacat tcttgttcgg        60
     tcctgccgcg gtggatacat gcatagcgtc tcgctgagcg aggcggcgat ggagaccgac       120
     gcagaaaccc tggcggaagc catcctgctc accgccgacg tgtcctgcct taaagcgttg       180
     ctggaagtac gcaacgagat cgtggcggcg ggccacaccc cgtccgcgca ggttcccacg       240
     accgacgacc tgaacgtcgc gatcgaaaag ctgctggccc atcaactgcg ccgccgtaac       300
     cgttga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page