(data stored in ACNUC7421 zone)

EMBL: CP001658.PE286

CP001658.PE286       Location/Qualifiers
FT   CDS_pept        331688..332608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23307"
FT                   /protein_id="ACT23307.1"
FT                   /translation="MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMG
FT                   VALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQK
FT                   AAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEA
FT                   DHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRG
FT                   IALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPR
FT                   FVREFPFNLMLWDLDRRMRRGRPLV"
     atggcgattt cgctggtggc tcaccagccc atcccccacg tcgagcgtcc catggccgac        60
     ccaccccgtc tccagctggc caggcgccgg cgatcggcgg ccggccccgg cggtaacgag       120
     gacagcttga tgggagtggc gctgctagcc ggcccggcca acgtgatcat ggagttggcg       180
     atgccgggtg tcggctacgg cgtgttggag agccgtgtcg aaagcggccg gctggaccgc       240
     catccgatca agcgggcgcg caccaccttt acctacgttg cggtggccgt tgccggcagc       300
     gacgaccaga aggcggcctt tcgtcgcgcg gtgaataagg ttcacgcgca ggtgtattcg       360
     actccggaga gcccggtgtc ctaccacgcg ttcgatcccg aactacagct gtgggtggcg       420
     gcatgcctct ataagggcgg cgtcgacgtc taccgcacct tcgtcggcga gatggacgac       480
     gaagaggccg accatcatta ccgcgcgggc atggcgatgg gcaccacgtt gcaggtgccg       540
     ccgcagatgt ggccaccgga tcgggcggcc ttcgaccgct actggcggca atcactggac       600
     agggtgcaca tcgatgacgt cgttcgcgac tacctgtatc cgatcgtggc gctccgaatt       660
     cgcgggatcg cactgccggg tccgctgcgg cggctgtcgg agggtatcgc gctgctgatc       720
     accaccggtt tcctgccgca gcggtttcgc gacgagatgc ggttgccgtg ggacgcgacc       780
     aagcagcggc gctttgacgc gctcatggcc gtgctgcgca cggtgaatcg cctgatgccg       840
     cggtttgtcc gggagttccc gttcaacctg atgctctggg acctggaccg gcggatgagg       900
     cgcgggcgcc cgctggtgta a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page