(data stored in ACNUC7421 zone)

EMBL: CP001658.PE289

CP001658.PE289       Location/Qualifiers
FT   CDS_pept        complement(333377..336280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03983"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03983"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23310"
FT                   /protein_id="ACT23310.1"
FT                   /translation="MLPLEMGCFLQPIFTGDRGGPGRRDRAVMPVGRCQMSFVIAAPEV
FT                   IAAAATDLASLESSIAAANAAAAANTTALLAAGADEVSTAVAALFGAHGQAYQALSAQA
FT                   QAFHAQFTQALTSGGGAYAAAEAAAVSPLLDPINEFFLANTGRPLIGNGTNGAPGTGAD
FT                   GAPGGWLIGNGGAGGSGAANNAVGGTGGTGGAGGASGLLGSGGAGGAGGVATNTGGIGG
FT                   AGGTGGNAVLFGAGGASTNTTGGAGGAGGDGGNAGLLFGAAGVGGAGGFALATTASGGA
FT                   GGAGGAGGMFTDGGVGGVGGKGGFGGAGGAGGNGGLFGAGGTGGAGGTIGAGVAGMGGA
FT                   GGAGGAGGLFGAGGTGGSGGGGATTGGDGGAGGNAGTLSLGAAGGAGGAGGEGLASAGG
FT                   DGGAGGDGGNAGMFFGSGGAGGAGGFGRTTGGIGGTGGNAGLLNGSGGAGGAGGAAITG
FT                   PGGTGGAGGIPGLIGNGGNGGDGGASVTGTGGNGGAGGNGVQIGNGGNGGSGGTGAAAG
FT                   KAGLGGLGGQLIGLDGSNAPVSTSVHTLQQAALNVVNEPFQTLTGRPLIGNGANGTPGT
FT                   GAAGGAGGWLFGNGGNGGHGATNTAATATGGAGGAGGILFGTGGNGGTGGIATGAGGIG
FT                   GAGGAGGVSLLIGSGGTGGNGGNSIGVAGIGGAGGRGGDAGLLFGAAGTGGHGAAGGVP
FT                   AGVGGAGGNGGLFANGGAGGAGGFNAAGGNGGNGGLFGTGGTGGAGTNFGAGGNGGNGG
FT                   LFGAGGTGGAAGSGGSGITTGGGGHGGNAGLLSLGASGGAGGSGGASSLAGGAGGNGAL
FT                   LFGFGGAGGAGGHGGAALTSIQQGGAGGAGGNGGLLFGSAGAGGAGGSGANALGAGTGG
FT                   TGGDGGHAGVFGNGGDGGCRRVWRRYRRQRWCRRQRRADRQRRQRRQRRQSRGHARCRR
FT                   HRRAAARRERTQRLAIAGRPATTRGVEGISCSPQMMP"
     gtgttgcccc tcgaaatggg atgcttctta cagccgattt tcactggtga ccggggaggc        60
     ccaggtcggc gcgacagagc ggtgatgccc gtcgggaggt gtcagatgtc gtttgtgatt       120
     gcggcgccag aggttatcgc ggcagcggca acggatttag ccagtctcga gtcgagcatc       180
     gccgcggcca acgcggccgc ggcggccaac accacggcgc tgctggccgc gggtgccgat       240
     gaagtctcga cggcggttgc ggcgctgttc ggcgcgcacg gccaggccta tcaggcgctc       300
     agtgcccaag cgcaggcgtt tcatgcccag ttcacgcagg cgttgacctc cggtggcggc       360
     gcgtacgccg ccgccgaggc cgccgcggtg tcgccgctgc tggatccgat taacgagttc       420
     ttcctggcga ataccgggcg cccgctgatc ggcaacggca ccaacggcgc ccccggcacc       480
     ggggccgacg gcgcgcccgg cggctggttg atcggcaacg gcggcgccgg cggatccggc       540
     gcggcgaaca acgccgttgg gggcaccggc gggactggcg gggccggcgg ggccagtggg       600
     ctgctcggca gcggcggggc gggcggcgcc ggcggggtcg ccaccaacac cggcgggatc       660
     ggcggggccg gcggtaccgg cgggaacgcc gtgttgttcg gcgccggcgg agcctcaacg       720
     aacaccaccg gcggggccgg tggtgcgggc ggggacggcg gcaacgccgg cctgctcttc       780
     ggcgccgccg gggtcggcgg cgccggcggg ttcgcattgg ccaccaccgc ctccggcggg       840
     gccggcggtg cgggcggggc cggcgggatg ttcaccgacg gcggggtcgg tggggtgggc       900
     ggaaaaggcg ggttcggcgg ggccggcggg gccggcggaa acggcggact gttcggcgcc       960
     ggcggcaccg gcggggccgg cggcaccatc ggcgccggtg tcgccgggat gggcggggcc      1020
     ggcggggccg gcggggccgg cggactgttc ggcgccggcg gcaccggcgg cagtggtggg      1080
     ggcggcgcta ccaccggcgg ggacggcggg gccggcggca acgccggcac gctctccctc      1140
     ggcgccgccg gcggcgccgg cggtgccggc ggggaaggcc ttgccagcgc cggcggggac      1200
     ggcggggccg gcggggacgg cggcaacgcg ggcatgttct tcggctccgg cggcgccggc      1260
     ggcgccggcg ggttcggccg caccaccggc gggataggag gcaccggcgg caacgccggc      1320
     ctgctcaacg gctccggcgg cgccggcggc gccggcggcg ctgctatcac cggtccaggc      1380
     ggcaccggcg gggccggtgg catacccggt ttgatcggca acggcggcaa cggcggtgac      1440
     ggcggcgcca gcgtgaccgg caccggcggc aacggcggag cgggcggtaa cggcgtgcag      1500
     atcggcaacg gcggcaacgg cggcagcggc gggaccggcg cagccgcggg caaggccggc      1560
     ctcggcggcc tcggcgggca gctaatagga ctagacggat ccaatgctcc agtcagcacc      1620
     tcagtccata ccctgcagca ggcagcgctc aatgtggtga atgagccctt ccagacattg      1680
     actgggcgtc cgctgatcgg caacggcgcc aacgggaccc cggggaccgg ggctgccggc      1740
     ggggccggcg ggtggttgtt cggcaacggc ggtaacggcg ggcacggtgc gaccaacacc      1800
     gccgccacgg ctacgggcgg ggccggcggg gccggcggga tcttgttcgg taccggtggc      1860
     aatggcggga ccggcgggat agccaccggt gctggaggga tcggcggggc cggcggcgcc      1920
     ggtggggtct ccttgctgat cggctccggc ggcaccggcg gcaacggtgg gaactccata      1980
     ggcgtcgctg gcatcggcgg ggccggcggg cgcggcggcg acgccggttt gctcttcggc      2040
     gcggccggca ccggcggcca cggcgccgct ggcggtgtcc cggccggcgt cggcggcgcc      2100
     ggcggcaacg gcggactgtt cgccaacggc ggagccggag gggccggcgg gttcaacgca      2160
     gccggcggga acggcgggaa cggcggactg ttcggaactg gcggcaccgg cggggccggc      2220
     acgaacttcg gggccggtgg gaacggcggg aacggcggac tgttcggagc cggcggcacc      2280
     ggcggcgccg ccggctcggg agggtccggg atcaccaccg gcggcggcgg gcacggcggc      2340
     aacgccggcc tactctccct cggcgcctcc ggtggcgccg gcggcagcgg tggcgccagc      2400
     tcccttgccg gcggggccgg cgggaacggc gccttactct tcggcttcgg cggcgccggc      2460
     ggcgccggcg ggcacggcgg ggcagcactt accagcatcc agcaaggcgg cgccggcggc      2520
     gccggcggga acggcggctt gctcttcggc tccgccggcg ccggcggcgc cggcggcagc      2580
     ggtgccaacg ctctaggcgc cggtaccggc ggcaccggcg gtgacggtgg ccacgccggg      2640
     gtgttcggca acggcggtga cgggggttgc cggcgggttt ggcgccggta ccggcggcag      2700
     cggtggtgtc ggcggcaacg ccgtgctgat cggcaacggc ggcaacggcg gcaacgccgg      2760
     caaagccggg gccacgcccg gtgccggcgg caccggcggg ctgctgctcg gcgagaacgg      2820
     actcaacggc ttgccatagc aggcagacct gcgaccacac gcggcgttga gggcatcagt      2880
     tgctcaccgc agatgatgcc gtag                                             2904
//

If you have problems or comments...

PBIL Back to PBIL home page