(data stored in ACNUC7421 zone)

EMBL: CP001658.PE290

CP001658.PE290       Location/Qualifiers
FT   CDS_pept        complement(336439..339198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00283"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23311"
FT                   /protein_id="ACT23311.1"
FT                   /translation="MRIGRCQMSFVIAAPEVIAAAATDLASLGSSISAANAAAAANTTA
FT                   LMAAGADEVSTAIAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSP
FT                   LLDPINEFFLANTGRPLIGNGANGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGN
FT                   GGAGGLIGNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGGVVALTGGAGGAG
FT                   GAGGNAGLLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGG
FT                   AGGAGGLFGAGGTGGHGGFADSSFGGVGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAG
FT                   GNAGMLALGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADG
FT                   GQGGPGGNAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGG
FT                   NGGIGGTGVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVL
FT                   NVVNEPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGSGATGTNGGDGGDGG
FT                   AGGIFFGTGGTGGAGGVGTTGTGGDGGAGGAAFLMGSGGNGGSGGAGLTAGGDGGDGGN
FT                   AGSFFGAAGTGGAGASTKAGGTGGTGGNGGLFANGGAGGSGGLGGDAGTGGAGGNGGLF
FT                   GAGGTGGAGGSLGPGAGGAGGNGGLFGAGGTGGAGGSLGPGAGGAGGNGGLFGAGGTGG
FT                   SGGAGGNAGLFSLGASGGAGGSGGSSLTDGGGIGGVGGAGGLLFGYGGAGGAGGYSNIG
FT                   AGGAGGAGGNAGMLSGSGGSGGTGGASGAAKGGVGGNGGTAGVFGNGGDGGAGGFGAGT
FT                   GGNGGVGGNAVLIGNGGNGGNGGKAGGTPGAGGTSGLLIGENGLNGLP"
     atgcgtattg ggaggtgtca gatgtcgttt gtgattgcgg cgccagaggt tatcgcggca        60
     gcggcaacgg atttggccag tctcggatcg agcatcagcg cggcaaacgc agccgcggcg       120
     gccaacacca cggcactgat ggccgcgggc gccgacgagg tgtcgacagc catcgccgcg       180
     ctgttcggcg cccacggcca ggcctatcag gcgctcagcg cccaagcgca ggcgtttcat       240
     gcccagttcg tgcaggcatt gacctccggt ggcggcgcct atgcggccgc cgaggccgcc       300
     gcggtgtcgc cgctgctgga tccgatcaac gagttcttcc tggcgaatac cgggcgcccg       360
     ttgatcggca acggcgccaa cggcgccccc ggcaccgggg ccaatggcgg ggacggcggc       420
     tggttaatcg gcaacggcgg cgccggagga tccggcgcgg ccggcgtcaa cggcggcgcc       480
     ggcggcaacg gcggcgccgg cgggctcatc ggcaacggcg gcgccggcgg cgctggcggg       540
     gtcgccagca gtgggatcgg cgggtccggc ggagccggcg gcaacgccat gctgttcggc       600
     gccggcggcg ccggcggcgc cggcggcggc gtagtagccc tcacgggcgg ggccggcggc       660
     gccggcgggg ctggcggcaa cgccggcctg ctcttcggcg ccgccggagt cggcggggcc       720
     ggcggattca cgaacggcag tgcactcggc ggggcgggcg gcgccggcgg ggccggcggg       780
     ctgttcgcca ccggcggggt cggcggatcc ggtggggccg gcagctccgg cggggccggt       840
     ggggccggtg gcgctggcgg gctgttcggc gccggcggca ccggcgggca tggcgggttc       900
     gccgacagca gcttcggcgg agtcggcggg gccggcgggg ccggcgggct gttcggcgca       960
     ggcggggaag gcggcagcgg cggacacagc ctggtcgccg gcggggacgg cggggccggc      1020
     ggcaatgccg gcatgctcgc cctcggcgcc gcgggcggcg ccggcggaat cggtggggac      1080
     ggcggtactc tcacggccgg cggcataggc ggcgccggcg gcgccggcgg caacgctggg      1140
     ctgctcttcg gctccggcgg ctccggcggc gccggcggat tcggcttcgc cgacggcggg      1200
     caaggcggcc ccgggggcaa cgccggcacg gtcttcggct ccggcggcgc cggcggcaac      1260
     ggcggagttg gccagggctt cgccggcggg atcggtgggg ctggcggcac ccccgggctg      1320
     atcggtaacg gcggcaacgg cggtaacggt ggcgccagcg cggtgaccgg cggcaacggc      1380
     gggatcggcg gcaccggcgt gttgatcggc aatggcggta acggcggtag cggtgggatt      1440
     ggcgcgggca aggccggagt gggcggcgtc agcgggctgc tgctcggtct agacggattc      1500
     aatgctcccg cgagcacctc gccactgcac accctgcagc aaaatgtgct caatgtggtg      1560
     aacgagccct tccagacgct caccggccgc ccgctgatcg gcaacggcgc caacgggact      1620
     cctggaaccg gggctgacgg cggggccggc gggtggctgt tcggcaacgg cggcaacggc      1680
     gggtccgggg cgaccggaac caacggcggg gacggtgggg acggcggcgc cggcgggatc      1740
     ttcttcggca ccggcggcac cggcggggcc ggcggcgtcg gcacgacggg caccggcggg      1800
     gacggcggcg ccggtggggc ggccttcttg atgggctccg gcggtaacgg cggcagcggc      1860
     ggcgccggcc tcaccgccgg tggggacggc ggggacggcg gtaacgccgg atcgttcttc      1920
     ggcgccgccg gaaccggcgg ggccggcgcc agcactaaag ccggcggcac cggcggcacc      1980
     ggcgggaacg gcgggctgtt tgccaacggc ggggccggcg ggagcggcgg gttgggcgga      2040
     gatgcgggga caggcggggc cggcgggaac ggcgggctgt tcggcgccgg cggcaccggc      2100
     ggcgccggcg gctccctcgg cccgggggcc ggtggtgccg gcgggaacgg tgggctgttc      2160
     ggcgccggcg gcaccggcgg cgccggcggc tccctcggcc cgggggccgg tggtgccggc      2220
     gggaacggtg ggctgttcgg cgccggcggc accggcggct ccggcggggc cggcggcaac      2280
     gcgggcttgt tctccctggg cgcttcgggt ggcgccggcg gtagcggcgg ctccagcttg      2340
     accgacggcg gcgggatcgg tggggtcggc ggagccggcg gcttgctctt cggctacggc      2400
     ggcgccggcg gcgccggcgg gtacagcaac atcggcgctg gtggggccgg cggggccggc      2460
     ggcaacgccg gcatgctctc cggctccggc ggctccggcg ggaccggcgg cgccagcggt      2520
     gccgccaagg gcggggtcgg cggcaacggc ggtacggccg gggtgttcgg caacggcggc      2580
     gacggcggtg ccggcgggtt tggcgccggt accggcggca atggcggtgt cggcggcaac      2640
     gccgtgctga tcggcaacgg cggcaacggc ggcaacggcg ggaaagccgg cggcacgccg      2700
     ggcgcgggcg gcaccagcgg gctgctgatc ggcgagaacg ggctcaacgg cctgccatag      2760
//

If you have problems or comments...

PBIL Back to PBIL home page