(data stored in ACNUC7421 zone)

EMBL: CP001658.PE292

CP001658.PE292       Location/Qualifiers
FT   CDS_pept        342231..343841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00285"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23313"
FT                   /protein_id="ACT23313.1"
FT                   /translation="MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADE
FT                   LIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAA
FT                   MPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAV
FT                   ASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGT
FT                   MNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQELFVNPVEAFQFYFELLLFDYPTHI
FT                   VQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPPTLP
FT                   AVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGF
FT                   GSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDP
FT                   DWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVP
FT                   GSWDPDRDAPGSAEPGDRG"
     atgacgctgt ggatggcctc gccgcccgag gtgcattcgg cgttgctcag cagcgggccg        60
     gggccgggct cggtgttgtc ggcggccggg gtgtggtcgt cgctgagcgc cgaatacgcc       120
     gcggtcgccg acgagctcat agggctgctg ggcgccgtgc agaccggcgc ttggcagggg       180
     cccagcgccg cggcttatgt ggccgcccac gcgccgtacc tcgcgtggtt aatgcgggcc       240
     agcgaaacca gcgcggaagc ggccgcccgg cacgagaccg tggccgcggc ctacacgacc       300
     gcggtggcgg ccatgccgac gttggtcgag ctggccgcca accacacgct tcacggggtc       360
     ttggtggcga cgaacttctt cggcatcaac accatcccga tcgcgctcaa cgaggccgac       420
     tacgcgcgga tgtggacgca ggccgccagc acgatggcga cctatcaagc ggtcgccgag       480
     gccgcggtgg cgtcggcacc gcagaccacc ccggcgccgc cgatcttggc agccgaagcg       540
     gccgacgatg accacgatca tgaccacgat cacgggggcg aaccgacccc gctggactat       600
     ctggtcgcgg agatattgcg catcatcagc ggtgggcgcc tgatctggga tcccgccgag       660
     ggcaccatga acggaatccc gttcgaagat tatacggacg cagcccaacc aatctggtgg       720
     gttgttcgtg ccatcgaatt cagtaaggac tttgaaacgt ttgttcagga actgtttgtc       780
     aatccggtgg aggcatttca gttctacttt gagcttctat tgttcgacta cccgacccac       840
     attgtgcaga ttgttgaggc gttgagccag tccccgcagt tgctggcggt cgcactcggt       900
     tccgtcatct ccaacttggg tgcggtgacc gggttcgccg ggctatccgg cttggccggc       960
     atgcagccgg cggctatccc ggcgctagca cccgtcgcgg cggccccgcc gacattgccg      1020
     gcggtcgcga tggccccgac catggccgcg ccgggcgcgg cggttgcgtc ggcagccgcg      1080
     ccggcgtccg cgccggcggc cagcacggtg gccagcgcca cgccggcacc gccgccggca      1140
     cccggcgccg ccgggttcgg ctatccctac gccatcgctc cgcccggcat cgggttcggc      1200
     tcggggatga gcgccagcgc cagcgctcaa cgcaaggcac cacagcccga tagtgcggcg      1260
     gcggcggcgg ccgcggcggc cgtacgtgac caagcgcggg cgcggcggcg gcgccgtgtc      1320
     acgcggcgcg gatacggcga cgagtttatg gatatgaaca tcgacgtcga tccggactgg      1380
     ggccctccgc ccggcgaaga cccagtcaca tccacggtgg cctcggatcg gggtgccgga      1440
     catctgggct ttgccgggac ggcccgcagg gaggcggttg ccgacgcggc cgggatgacc      1500
     acgctggctg gcgatgattt cggcgacggg ccaacgacgc caatggtgcc gggttcgtgg      1560
     gatccggacc gggatgcgcc tggctcggcg gagcctggag atcggggctg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page