(data stored in ACNUC7421 zone)

EMBL: CP001658.PE293

CP001658.PE293       Location/Qualifiers
FT   CDS_pept        343865..344773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23314"
FT                   /protein_id="ACT23314.1"
FT                   /translation="MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFC
FT                   RAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILA
FT                   AGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQA
FT                   LRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYA
FT                   AKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVP
FT                   GPESEAGPMFARNTLVSAARV"
     gtgcgtaccg aaggtgatag ctgggacatc acaacgagtg tcggttcgac cgcgctgttt        60
     gtcgcgacgg cgcgagcgct ggaagcccag aagtccgacc cgctggtcgt cgacccatat       120
     gcggaggcgt tctgccgtgc cgtcggcggt tcgtgggccg atgtgctcga cggcaagctt       180
     cccgaccaca agttgaagag caccgatttc ggcgagcact tcgtcaactt ccagggtgcc       240
     cgcaccaagt atttcgacga gtatttccgt cgggccgccg ccgccggcgc gcggcaggtg       300
     gtcatcctgg cggcggggct ggactcgcgc gcgtaccggc tgccttggcc cgacgggacc       360
     acggtttttg agctggaccg cccgcaggtc cttgatttca agcgcgaggt gctcgccagc       420
     cacggtgccc aaccgcgcgc cctgcgccgc gagatcgccg tcgacctgcg tgacgattgg       480
     ccacaagcct tgcgggacag tggtttcgat gcggctgcac cgtcggcatg gattgccgaa       540
     gggctgctga tctatctccc ggccaccgcc caggagcggc tattcaccgg catcgatgcc       600
     ctggccgggc gccgaagcca cgtcgccgtc gaggatggtg ccccaatggg gccagacgaa       660
     tatgcggcta aggtcgaaga ggagcgcgcc gcgatcgccg agggagccga ggagcacccg       720
     ttttttcaac tggtctacaa cgagcgatgc gcgccggccg ccgagtggtt cggcgagcga       780
     ggttggaccg cggtcgctac gctgttgaac gactacctcg aagcggtggg tcgcccggta       840
     cccggaccgg aatccgaagc cgggccgatg ttcgcccgca acaccctggt cagtgccgcc       900
     cgcgtctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page