(data stored in ACNUC7421 zone)

EMBL: CP001658.PE295

CP001658.PE295       Location/Qualifiers
FT   CDS_pept        346889..348505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00288"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23316"
FT                   /protein_id="ACT23316.1"
FT                   /translation="MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGW
FT                   RFVMRRIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSN
FT                   AVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPG
FT                   APERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLV
FT                   DSGAGTWLLWDGKRSPIDLADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPII
FT                   PDAGNPASFGVPAPIGAVVSSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNN
FT                   NSYGLQQPPRLGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATS
FT                   SLTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLF
FT                   WVSDTGVRYGIDNEPQGVAGGGKAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLA
FT                   HDTLVPDSRPARPVSAEGGYR"
     atgacgaacc agcagcacga ccacgacttc gaccacgacc gtcgctcgtt cgcctcccga        60
     accccggtca acaacaaccc cgacaaggtt gtctaccgcc gcggcttcgt cacccgccat       120
     caggtgacgg gctggcggtt cgtgatgcgc cgaatcgccg ccggaatcgc attgcacgac       180
     acccgcatgc tggtcgaccc gttgcgcact cagtcacgcg cggtgctgat gggtgtgctg       240
     attgtgatca cggggttgat cggctccttc gtattctcgt tgattcggcc caatgggcag       300
     gcgggtagca acgcggtgct tgccgaccgg tccaccgcgg cgctgtatgt gcgggtgggc       360
     gagcagctgc acccggtgct caacctgacc tcggcccggc tgatcgtcgg ccggccggtg       420
     agcccgacga cggtgaaaag tactgagttg gaccagtttc cgcgcggaaa cctgatcggc       480
     atcccgggtg cgccggagcg gatggtgcag aacacctcca ccgacgcgaa ctggacggtg       540
     tgtgacggcc tcaacgcacc gtcgcggggc ggtgcggatg gcgtgggtgt gacggtgatt       600
     gccggcccgc tggaggacac cggcgcacgc gcggccgcgc tcgggcccgg gcaggcggtg       660
     ctggtcgaca gcggcgccgg cacctggctg ttgtgggacg gcaagcgcag cccgattgat       720
     ctggccgatc atgcggtcac cagcggcctc ggcctgggcg ccgacgtgcc cgcgccgcgg       780
     atcatcgcct cggggctgtt caacgcgata cccgaagcac cgccactgac ggcgccgatc       840
     atcccggatg ccggcaaccc ggcgagcttc ggtgtgccgg cgccgatcgg cgcggtggtg       900
     agttcctacg ccctgaaaga ctcgggcaag accatatcgg acaccgtgca gtactacgcg       960
     gtgctgccgg acggtttgca gcagatttcg ccggtattgg cggcaatcct gcgcaacaac      1020
     aactcctatg gtctgcagca gccgcctcgg ctgggggccg acgaggtcgc caagctgccg      1080
     gtgtcgcggg tgttggacac caggcgctat cccagcgagc cggtaagtct cgtcgacgtt      1140
     acccgtgacc ccgtcacctg cgcgtactgg agcaagccgg tgggtgcggc caccagctcg      1200
     ttgactctgt tggcaggctc ggcgctgccg gtgccagatg cggtgcacac cgtcgagctg      1260
     gtcggcgccg gcaacggtgg tgtggcaacc cgagtggcgt tagcggccgg tactggctac      1320
     ttcacccaga cggtgggcgg cggcccagat gcgccgggcg ccgggtcgtt gttctgggtg      1380
     tcggataccg gggtgcgtta cggtatcgac aatgagcctc agggagtggc tggaggcggc      1440
     aaagcggttg aggcccttgg cctgaacccg cccccggtcc ccatcccgtg gtcggtgctg      1500
     tcgctgtttg tgcccggccc gacgctgtcg cgtgccgacg cgctgctggc acacgacacc      1560
     ttggtgcccg acagcaggcc cgctcgtccg gtatcggccg agggagggta ccggtga         1617
//

If you have problems or comments...

PBIL Back to PBIL home page