(data stored in ACNUC7421 zone)

EMBL: CP001658.PE298

CP001658.PE298       Location/Qualifiers
FT   CDS_pept        352802..354343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00291"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23319"
FT                   /protein_id="ACT23319.1"
FT                   /translation="MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTA
FT                   AELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTAL
FT                   AAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGA
FT                   ALASAPRTVPAPTVMNPGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQF
FT                   LQDPIGNSIKIIIAFLTNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPA
FT                   GLGLGLAAIAFLPIVLAPAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAA
FT                   GAAPSAGAAPAPAAPATASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAA
FT                   TRGQSRARRRRRSELRDYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKE
FT                   RRVRAVGLTALAGDEFGNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK"
     atggccgcgc ccatctggat ggcttcgccg ccggaggtac attcggcgtt gcttagcaat        60
     ggtccgggcc cgggttcgct agtggcggct gccacggcct ggagccagct gagtgccgag       120
     tatgcctcga cggcagcaga actcagtggg ctactggggg cggtacctgg ttgggcatgg       180
     caggggccca gcgcggagtg gtacgtggcc gcgcatttgc catatgtggc gtggctgacg       240
     caggccagtg cggatgccgc aggagcagcg gcccagcacg aggccgccgc ggcggcctac       300
     accactgcct tggcagccat gccgacatta gcggagttgg ccgccaacca cgtgattcac       360
     accgtgttgg tggcgacgaa tttctttggg atcaacacga ttcccatcac gctcaatgag       420
     gccgattacg tgcgcatgtg gttgcaggcg gccgccgtca tgggtcttta tcaggcggct       480
     tcgggtgcgg cactggcttc ggcgccgcgc accgtcccgg cgccgacggt tatgaatcca       540
     ggtggcggtg cggcgagcac tgtcggggcg gtcaacccct ggcagtggct cttagcgttg       600
     cttcaacagc tctggaacgc ctacacgggt ttctacgggt ggatgttgca gctcatctgg       660
     cagttcctgc aggatcccat tggtaactcg atcaagatca tcatcgcctt cctcacgaat       720
     cccattcagg cactgatcac ttacgggccg ctgttgttcg cgctgggcta ccagattttc       780
     ttcaacctgg tcggctggcc gacctggggc atgatcttga gctcgccgtt cttgttgccg       840
     gccgggctcg ggctgggctt ggcagcaata gcctttctac ctattgtgct tgcgcccgcg       900
     gtgattccgc cggcgagtac tccgctggct gctgccgccg tcgccgccgg gtcggtgtgg       960
     ccggcggtca gcatggccgt aacgggggcg ggcaccgctg gggctgcgac gcccgcggcg      1020
     ggcgcggctc cgtctgcggg cgcagcgccg gccccggcag ctcccgcgac cgccagtttc      1080
     gcctatgcgg tgggtggcag cggtgattgg gggccgagct tggggccgac ggtaggtggt      1140
     cgcggtggta tcaaggcgcc ggccgctacg gttccggcgg cggccgcggc ggcggcaact      1200
     cgtgggcagt cgcgcgcgcg gcggcgccgg cggtctgaat tgcgggacta cggcgacgag      1260
     ttcttggaca tggattccga tagcggtttc ggcccctcga cgggcgacca cggcgcgcag      1320
     gcctccgaac ggggggccgg gacgctggga ttcgccggga ccgcaaccaa agaacgccgg      1380
     gtccgggcgg tcgggctgac cgcactggcc ggtgatgagt tcggcaacgg cccccggatg      1440
     ccgatggtgc cggggacctg ggagcagggc agcaacgagc ccgaggcgcc cgacggatcg      1500
     gggagagggg gaggcgacgg cttaccgcac gacagcaagt aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page