(data stored in ACNUC7421 zone)

EMBL: CP001658.PE299

CP001658.PE299       Location/Qualifiers
FT   CDS_pept        354392..354685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00292"
FT                   /product="esat-6 like protein esxG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23320"
FT                   /protein_id="ACT23320.1"
FT                   /translation="MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQG
FT                   ESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF"
     atgagccttt tggatgctca tatcccacag ttggtggcct cccagtcggc gtttgccgcc        60
     aaggcggggc tgatgcggca cacgatcggt caggccgagc aggcggcgat gtcggctcag       120
     gcgtttcacc agggggagtc gtcggcggcg tttcaggccg cccatgcccg gtttgtggcg       180
     gcggccgcca aagtcaacac cttgttggat gtcgcgcagg cgaatctggg tgaggccgcc       240
     ggtacctatg tggccgccga tgctgcggcc gcgtcgacct ataccgggtt ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page