(data stored in ACNUC7421 zone)

EMBL: CP001658.PE3

CP001658.PE3         Location/Qualifiers
FT   CDS_pept        3382..4539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00003"
FT                   /product="DNA replication and repair protein recF"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23024"
FT                   /protein_id="ACT23024.1"
FT                   /translation="MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWY
FT                   STTLGSHRVSADLPLIRVGTDRAVISTIVVNDGRECAVDLEIATGRVNKARLNRSSVRS
FT                   TRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLAIVRRPAIAAVRAEYERVLRQRTA
FT                   LLKSVPGARYRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQLLAPE
FT                   SRSASIGYRASMDVTGPSEQSDTDRQLLAARLLAALAARRDAELERGVCLVGPHRDDLI
FT                   LRLGDQPAKGFASHGEAWSLAVALRLAAYQLLRVDGGEPVLLLDDVFAELDVMRRRALA
FT                   TAAESAEQVLVTAAVLEDIPAGWDARRVHIDVRADDTGSMSVVLP"
     gtgtacgtcc gtcatttggg gctgcgtgac ttccggtcct gggcatgtgt agatctggaa        60
     ttgcatccag ggcggacggt ttttgttggg cctaacggtt atggtaagac gaatcttatt       120
     gaggcactgt ggtattcgac gacgttaggt tcgcaccgcg ttagcgccga tttgccgttg       180
     atccgggtag gtaccgatcg tgcggtgatc tccacgatcg tggtgaacga cggtagagaa       240
     tgtgccgtcg acctcgagat cgccacgggg cgagtcaaca aagcgcgatt gaatcgatca       300
     tcggtccgaa gtacacgtga tgtggtcgga gtgcttcgag ctgtgttgtt tgcccctgag       360
     gatctggggt tggttcgtgg ggatcccgct gaccggcggc gctatctgga tgatctggcg       420
     atcgtgcgta ggcctgcgat cgctgcggta cgagccgaat atgagagggt gttgcgccag       480
     cggacggcgt tattgaagtc cgtacctgga gcacggtatc ggggtgaccg gggtgtgttt       540
     gacactcttg aggtatggga cagtcgtttg gcggagcacg gggctgaact ggtggccgcc       600
     cgcatcgatt tggtcaacca gttggcaccg gaagtgaaga aggcatacca gctgttggcg       660
     ccggaatcgc gatcggcgtc tatcggttat cgggccagca tggatgtaac cggtcccagc       720
     gagcagtcag ataccgatcg gcaattgtta gcagctcggc tgttggcggc gctggcggcc       780
     cgtcgggatg ccgaactcga gcgtggggtt tgtctagttg gtccgcaccg tgacgaccta       840
     atactgcgac taggcgatca acccgcgaaa ggatttgcta gccatgggga ggcgtggtcg       900
     ttggcggtgg cactgcggtt ggcggcctat caactgttac gcgttgatgg tggtgagccg       960
     gtgttgttgc tcgacgacgt gttcgccgaa ctggatgtca tgcgccgtcg agcgttggcg      1020
     acggcggccg agtccgccga acaggtgttg gtgactgccg cggtgctcga ggatattccc      1080
     gccggctggg acgccaggcg ggtgcacatc gatgtgcgtg ccgatgacac cggatcgatg      1140
     tcggtggttc tgccatga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page