(data stored in ACNUC7421 zone)

EMBL: CP001658.PE301

CP001658.PE301       Location/Qualifiers
FT   CDS_pept        355016..355903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23322"
FT                   /protein_id="ACT23322.1"
FT                   /translation="MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGA
FT                   FVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGI
FT                   VALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEF
FT                   SLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGR
FT                   HTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWF
FT                   PGQRVSRDFSTQSS"
     atggatgcaa cacccaacgc cgtcgagctg acggtcgaca acgcttggtt catcgctgaa        60
     accattgggg cggggacctt tccgtgggtg ctggcgatca cgatgcccta tagtgatgcc       120
     gcccagcggg gtgcgttcgt cgaccgtcag cgcgacgagc tgacccggat ggggctgtta       180
     tcgccgcagg gtgttatcaa ccctgcggtc gccgactgga tcaaagtggt gtgcttcccg       240
     gaccgctggc ttgacctgcg ttatgtgggg ccggcctcgg ccgacggcgc ctgcgagctg       300
     ctacgtggca tcgtcgcgct gcgcaccggc accggtaaga cctccaacaa gaccggaaac       360
     ggtgttgttg cgctgcgtaa tgcgcagctg gtcacgttca ccgcgatgga tatcgacgac       420
     ccccgggcgc tggttccgat tcttggtgtc ggtttggcgc accggccgcc ggcgcggttc       480
     gacgagttca gcttgccgac gcgggtgggc gcgcgggccg acgaacggct gcggtccggc       540
     gtgccactcg gggaagtcgt tgactatctg ggtattccgg cgtccgcacg gccggtggtg       600
     gagtccgtct tctcggggcc gcgcagctac gtcgagatcg tcgccgggtg caaccgtgac       660
     ggccggcaca ccaccaccga ggtcggccta agcatcgtcg acacctcggc gggccgggtg       720
     ttggtgagtc cgtcgcgggc attcgacggc gagtgggtct ccaccttcag ccctgggaca       780
     ccgtttgcga tcgccgtcgc gatccaaaca ctgaccgcgt gcttgccaga cgggcaatgg       840
     ttcccgggac agcgggtgtc gcgggacttc tccacccaat cctcgtaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page