(data stored in ACNUC7421 zone)

EMBL: CP001658.PE304

CP001658.PE304       Location/Qualifiers
FT   CDS_pept        358747..359742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00297"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23325"
FT                   /protein_id="ACT23325.1"
FT                   /translation="MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVV
FT                   IGLFGFWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLI
FT                   ARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVA
FT                   ARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSADAELPD
FT                   TLPAIRSRPAQETWIALEIAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNH
FT                   VPALTALDPRSTRRLDGHTDAPADLLTRLHWPTPTAGAHRAPLTNAVSRT"
     atgaacccga tcccttcttg gcccggcagg ggccgggtca cgttggtgct gctggcggtg        60
     gtgcctgtag cgctggccta cccctggcaa tcgacacgcg attacgtgct gctgggcgtg       120
     gccgccgccg tcgtgattgg gctattcggc ttctggcgcg ggctgtattt caccacgatc       180
     gcgcgccgcg ggttggcaat cctgcgccgc cgacgccgga ttgccgagcc cgcaacgtgc       240
     acgcgcacaa cggtgctggt gtgggttggg ccgccggcat cggatacgaa cgtgctgccg       300
     ctgacgctga tcgcccggta tttggaccga tacggcatcc gcgccgacac gattcgcatc       360
     accagccgcg tcaccgcatc cggcgactgc cggacctggg tcgggttgac ggtggtcgcc       420
     gacgataacc tggcggcgct gcaggcccgg tcagcgcgca tccccttgca agagaccgcg       480
     caggtcgcgg cgcgccggct cgccgaccat ctgcgcgaaa tcggttggga ggctggtacg       540
     gccgcacccg acgagatccc agcgttggtg gctgcggatt ctcgcgagac gtggcgcgga       600
     atgcggcaca ccgactcgga ttacgttgcg gcatatcggg tcagcgccga tgccgagttg       660
     cccgatacgt tgcccgcgat ccggtcgcgt ccggcgcagg agacctggat cgcgctggag       720
     atcgcatatg ccgccgggtc atcaacccgc tacacggtgg ccgctgcctg cgcattgcgg       780
     accgattggc ggcctggcgg caccgcaccg gtggccggcc tgctcccgca acacggaaac       840
     cacgtgccag ccctgacagc cttggatccg cgatccaccc gccgactcga cgggcacacc       900
     gatgctcctg ccgacctgct gacccggctg cactggccta ctcctaccgc cggcgcccac       960
     cgggcaccgc tgaccaacgc cgtcagtcga acatga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page