(data stored in ACNUC7421 zone)

EMBL: CP001658.PE305

CP001658.PE305       Location/Qualifiers
FT   CDS_pept        complement(359729..360931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23326"
FT                   /protein_id="ACT23326.1"
FT                   /translation="MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVES
FT                   SAIADVALRTAVASVLSATVTPAVVANALRHVNEGSERSNLNFYAELAAAHDPAKSFPA
FT                   PTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSALTANNIVHAQHWR
FT                   HRDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGQRAEKFSPFSG
FT                   FGYFTSGLSGFAEAMAQAVYDFRSIVDYLRHIGVDRIALTGISLGGYTSALLASVESRL
FT                   EAVIPNCPVVMPAKLFDEWFPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKD
FT                   RRMIITGLGDRMAPPEHAVTLWKQWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMF
FT                   D"
     atgtcaggga cgttcactgc cgacgcgatc ggtccgcccg tccccattcc cgacgtcccc        60
     ggcgcggatg ccggcgccga gggcctgccc tcgcgctcgg tgctgtcggc ccgccagcgg       120
     atactcgtcg agtcttcggc gatcgccgat gtcgcgctgc gcaccgcggt cgcgtcggtg       180
     ctgtccgcga cggtgactcc ggccgttgtc gccaacgcac tacgtcacgt caacgaaggc       240
     agcgagcgca gcaacctgaa cttctacgcc gaacttgcgg cagcgcatga tccggcgaag       300
     tcctttccgg cgccgacgga gttgcccaag gtcacctcgc ggccggccag cccgctcacc       360
     gaatgggttg cgcgcggcac cgtggacaac atcgcatttg ccagcggctt ccgggcgatc       420
     aaccccacga tgcgccagcg gtggagtgca ttgaccgcca acaacattgt gcacgcgcag       480
     cactggcgcc accgcgacgg cccgcgtcct acgctgtgcg tcatccacgg cttcatggga       540
     tcgtcatact tgctcaacgg gctgttcttt tcgctgcctt ggtattaccg gtccggctac       600
     gacgttttgc tgtacacgtt gccgtttcac ggccagcggg ccgaaaagtt ctcgccgttt       660
     agcggtttcg gctatttcac tagcggattg agcggcttcg ccgaggcgat ggcgcaggca       720
     gtgtatgact ttcgttccat cgtggactac ctgcgccaca tcggcgtcga ccgtatcgcc       780
     ctgacgggta tatccctggg gggctacacg tctgcgctgc tggcttcggt cgaaagtcgg       840
     cttgaggctg tcatccccaa ctgccccgtc gtcatgcccg ccaagctgtt cgacgaatgg       900
     tttccggcca ataagctcgt caagctagga ctgcggctaa ccaacatcag ccgtgatgag       960
     ctgatcgccg ggctggccta ccacggccca ctgaactatc ggccgctgct acctaaggac      1020
     cggcggatga tcatcaccgg ccttggcgat cgaatggctc cacccgagca cgcggtaacg      1080
     ctgtggaagc agtgggatcg ctgtgcgctg cactggttcc ccggcagcca cctgctgcat      1140
     gtgagccagt tggactatct gcggcggatg accgtgttcc tgcagggcct catgttcgac      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page